F004178

General Info

Members Datasets Scaffolds Average Seq Length
100 76 200 145

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0345753|Ga0373933_0345753_173_667
Length 164
Sequence MGFTAMLAEEYLLIVPFALNFIICMEVQEQIKKYITSQPEPKRSDMQALHRIVLQVMPACKLWFLDGKNSENKTVSNPNIGYGFQTIKYADGKTREFYQIGISANKTGISVYILGIKDKKYLAQTYGKKLGKASVSGYCIKFKTLKDINITILEAAIRYGFVNK

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
62 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
68 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
71 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
72 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
73 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
74 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
75 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
76 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 1
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0345753 3300035724 Bacteria 966
2 JGI24751J29686_10046466 3300002459 Bacteria 897
3 rootH1_10056811 3300003323 Bacteria 1346
4 Ga0065704_10184065 3300005289 Bacteria 1222
5 Ga0065704_10235332 3300005289 Bacteria 1031
6 Ga0065712_10390463 3300005290 Bacteria 730
7 Ga0070670_100066480 3300005331 Bacteria 3094
8 Ga0070666_10074437 3300005335 Bacteria 2315
9 Ga0070666_10144232 3300005335 Bacteria 1659
10 Ga0070674_100366701 3300005356 Bacteria 1168
11 Ga0070673_101180744 3300005364 Bacteria 717
12 Ga0070694_100225900 3300005444 Bacteria 1406
13 Ga0070662_100066861 3300005457 Bacteria 2638
14 Ga0068867_100572044 3300005459 Bacteria 982
15 Ga0070699_100034126 3300005518 Bacteria 4397
16 Ga0070672_100453466 3300005543 Bacteria 1105
17 Ga0070696_100117301 3300005546 Bacteria 1923
18 Ga0070665_100000075 3300005548 Bacteria 189496
19 Ga0070704_100584514 3300005549 Bacteria 980
20 Ga0070664_101028734 3300005564 Bacteria 775
21 Ga0068857_100078332 3300005577 Bacteria 2950
22 Ga0068856_100594125 3300005614 Bacteria 1128
23 Ga0068859_100419285 3300005617 Bacteria 1435
24 Ga0068859_100773746 3300005617 Bacteria 1048
25 Ga0068859_101612507 3300005617 Bacteria 717
26 Ga0068861_102327170 3300005719 Bacteria 538
27 Ga0068863_100872591 3300005841 Bacteria 899
28 Ga0070715_10051391 3300006163 Bacteria 1774
29 Ga0075366_10322089 3300006195 Bacteria 947
30 Ga0097621_100243261 3300006237 Bacteria 1573
31 Ga0068871_100140459 3300006358 Bacteria 2053
32 Ga0068871_100589752 3300006358 Unclassified 1010
33 Ga0075428_100102014 3300006844 Bacteria 3128
34 Ga0075428_100431060 3300006844 Bacteria 1413
35 Ga0097620_100419281 3300006931 Bacteria 1435
36 Ga0097620_100773712 3300006931 Bacteria 1048
37 Ga0097620_101612407 3300006931 Bacteria 717
38 Ga0105245_10227036 3300009098 Bacteria 1804
39 Ga0114129_10665128 3300009147 Bacteria 1343
40 Ga0105243_10613896 3300009148 Bacteria 1049
41 Ga0105243_11019748 3300009148 Bacteria 831
42 Ga0105242_10034759 3300009176 Bacteria 4041
43 Ga0105249_10008494 3300009553 Bacteria 8950
44 Ga0157326_1001978 3300012513 Bacteria 2226
45 Ga0157371_10307841 3300013102 Bacteria 1148
46 Ga0157374_10000042 3300013296 Bacteria 147627
47 Ga0157374_10090571 3300013296 Bacteria 2916
48 Ga0157374_10325232 3300013296 Bacteria 1524
49 Ga0157378_10131765 3300013297 Bacteria 2315
50 Ga0157378_10142513 3300013297 Bacteria 2227
51 Ga0163162_10025524 3300013306 Bacteria 5840
52 Ga0163162_10604566 3300013306 Bacteria 1222
53 Ga0163162_10792226 3300013306 Bacteria 1065
54 Ga0157375_10777977 3300013308 Bacteria 1107
55 Ga0157375_12524669 3300013308 Unclassified 614
56 Ga0163163_10000389 3300014325 Bacteria 41878
57 Ga0163163_11975329 3300014325 Bacteria 643
58 Ga0157380_10174229 3300014326 Bacteria 1883
59 Ga0157380_10202790 3300014326 Bacteria 1761
60 Ga0157376_10003061 3300014969 Bacteria 11465
61 Ga0157376_11661074 3300014969 Bacteria 674
62 Ga0213876_10001710 3300021384 Bacteria 13330
63 Ga0207642_10769213 3300025899 Bacteria 611
64 Ga0207680_10030477 3300025903 Bacteria 3043
65 Ga0207685_10212924 3300025905 Bacteria 915
66 Ga0207654_11071693 3300025911 Bacteria 587
67 Ga0207650_10097907 3300025925 Bacteria 2253
68 Ga0207706_10025883 3300025933 Bacteria 5254
69 Ga0207691_10650437 3300025940 Bacteria 891
70 Ga0207679_10518420 3300025945 Bacteria 1066
71 Ga0207667_10000093 3300025949 Bacteria 145814
72 Ga0207667_11984883 3300025949 Bacteria 542
73 Ga0207712_10016171 3300025961 Bacteria 4824
74 Ga0207641_10845026 3300026088 Bacteria 907
75 Ga0268266_10000103 3300028379 Bacteria 179736
76 Ga0268264_10011707 3300028381 Bacteria 7234
77 Ga0307509_10033672 3300031507 Bacteria 5638
78 Ga0307509_10044287 3300031507 Bacteria 4810
79 Ga0307509_10512638 3300031507 Bacteria 882
80 Ga0307408_100663960 3300031548 Bacteria 933
81 Ga0436365_0269340 3300039437 Bacteria 68150
82 Ga0451787_357323 3300041441 Unclassified 668
83 Ga0439445_0000139 3300042004 Bacteria 12692
84 Ga0451577_0133180 3300042876 Bacteria 2231
85 Ga0451577_0334504 3300042876 Bacteria 1373
86 Ga0451577_1760625 3300042876 Bacteria 544
87 Ga0453683_0440368 3300044673 Bacteria 842
88 Ga0453684_0047485 3300044712 Bacteria 5693
89 Ga0453684_0280983 3300044712 Bacteria 1898
90 Ga0495651_0711815 3300046462 Bacteria 625
91 Ga0495605_0124821 3300046474 Bacteria 1165
92 Ga0495642_0206964 3300046528 Bacteria 856
93 Ga0495622_0284086 3300046557 Bacteria 723
94 Ga0495672_0170228 3300047320 Bacteria 1111
95 Ga0495680_0799346 3300047322 Bacteria 616
96 Ga0495686_0000241 3300047472 Bacteria 98943
97 nmdc:mga0k408_332542_c1 3300050493 Bacteria 906
98 nmdc:mga05p37_1386171_c1 3300050507 Unclassified 709
99 nmdc:mga06r32_328928_c1 3300050510 Bacteria 1513
100 Ga0500645_091051 3300053730 Bacteria 865
101 Ga0373933_0345753
102 JGI24751J29686_10046466
103 rootH1_10056811
104 Ga0065704_10184065
105 Ga0065704_10235332
106 Ga0065712_10390463
107 Ga0070670_100066480
108 Ga0070666_10074437
109 Ga0070666_10144232
110 Ga0070674_100366701
111 Ga0070673_101180744
112 Ga0070694_100225900
113 Ga0070662_100066861
114 Ga0068867_100572044
115 Ga0070699_100034126
116 Ga0070672_100453466
117 Ga0070696_100117301
118 Ga0070665_100000075
119 Ga0070704_100584514
120 Ga0070664_101028734
121 Ga0068857_100078332
122 Ga0068856_100594125
123 Ga0068859_100419285
124 Ga0068859_100773746
125 Ga0068859_101612507
126 Ga0068861_102327170
127 Ga0068863_100872591
128 Ga0070715_10051391
129 Ga0075366_10322089
130 Ga0097621_100243261
131 Ga0068871_100140459
132 Ga0068871_100589752
133 Ga0075428_100102014
134 Ga0075428_100431060
135 Ga0097620_100419281
136 Ga0097620_100773712
137 Ga0097620_101612407
138 Ga0105245_10227036
139 Ga0114129_10665128
140 Ga0105243_10613896
141 Ga0105243_11019748
142 Ga0105242_10034759
143 Ga0105249_10008494
144 Ga0157326_1001978
145 Ga0157371_10307841
146 Ga0157374_10000042
147 Ga0157374_10090571
148 Ga0157374_10325232
149 Ga0157378_10131765
150 Ga0157378_10142513
151 Ga0163162_10025524
152 Ga0163162_10604566
153 Ga0163162_10792226
154 Ga0157375_10777977
155 Ga0157375_12524669
156 Ga0163163_10000389
157 Ga0163163_11975329
158 Ga0157380_10174229
159 Ga0157380_10202790
160 Ga0157376_10003061
161 Ga0157376_11661074
162 Ga0213876_10001710
163 Ga0207642_10769213
164 Ga0207680_10030477
165 Ga0207685_10212924
166 Ga0207654_11071693
167 Ga0207650_10097907
168 Ga0207706_10025883
169 Ga0207691_10650437
170 Ga0207679_10518420
171 Ga0207667_10000093
172 Ga0207667_11984883
173 Ga0207712_10016171
174 Ga0207641_10845026
175 Ga0268266_10000103
176 Ga0268264_10011707
177 Ga0307509_10033672
178 Ga0307509_10044287
179 Ga0307509_10512638
180 Ga0307408_100663960
181 Ga0436365_0269340
182 Ga0451787_357323
183 Ga0439445_0000139
184 Ga0451577_0133180
185 Ga0451577_0334504
186 Ga0451577_1760625
187 Ga0453683_0440368
188 Ga0453684_0047485
189 Ga0453684_0280983
190 Ga0495651_0711815
191 Ga0495605_0124821
192 Ga0495642_0206964
193 Ga0495622_0284086
194 Ga0495672_0170228
195 Ga0495680_0799346
196 Ga0495686_0000241
197 nmdc:mga0k408_332542_c1
198 nmdc:mga05p37_1386171_c1
199 nmdc:mga06r32_328928_c1
200 Ga0500645_091051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ch3-assembly1.cif.gz_X crystal structure analysis of sera5e from plasmodium falciparum 0.5305 54 83
6lrd-assembly1.cif.gz_A structure of recj complexed with a 5'-p-dspacer-modified ssdna 0.4778 75 139
8jcy-assembly1.cif.gz_2 cryo-em structure of mglu2-mglu3 heterodimer in presence of ly341495, nam563, and ly2389575 (dimerization mode i) 0.4743 44 77
5jlt-assembly1.cif.gz_A the crystal structure of the bacteriophage t4 mota c-terminal domain in complex with dsdna reveals a novel protein-dna recognition motif 0.4663 20 137
4asc-assembly1.cif.gz_A crystal structure of the kelch domain of human kbtbd5 0.4645 51 89
ID Description Score Start End Superfamily
af_Q9VCU5_211_310_1.10.1580.10 Mainly Alpha;Orthogonal Bundle;Conserved Hypothetical Protein Ylqf; Chain: A; domain 2; 0.9644 60 74 1.10.1580.10
af_Q554S6_186_270_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.7939 60 75 3.90.640.10
af_Q55DS6_195_285_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.7877 60 74 3.90.640.10
af_Q8IS11_717_944_1.10.840.10 Mainly Alpha;Orthogonal Bundle;Son of Sevenless (SoS) protein; Chain S, domain 2;Ras guanine-nucleotide exchange factors catalytic domain 0.7829 60 74 1.10.840.10
af_Q4DNX7_74_210_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7309 59 79 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A7W5Q1R6-F1-model_v4 YdhG-like domain-containing protein 0.994 1 135
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.9902 1 137
AF-A0A6B8RMY4-F1-model_v4 DUF1801 domain-containing protein 0.9877 1 138
AF-A0A257H5R8-F1-model_v4 YdhG-like domain-containing protein 0.9855 2 137
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.984 1 138

Map