F004181

General Info

Members Datasets Scaffolds Average Seq Length
100 73 198 179

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0038296|Ga0373947_0038296_808_1440
Length 210
Sequence VDDHASIIRAPGGCHACFACLIGAIMTTAVSTLAVPGASPIQPTNVEKHFDRGDIIVSKTDTKGRITYANAVFCAVSGYTLPQLIGAPHSLIRHPDMPRAVFKLLWDTILDRREVFAYVKNLSKSGAYYWVFAHVTPSYSRDGQIIGFHSNRRVPERRILDDVIIPLYAEVLREEAKHRNGKDALAAGFKYLVDFVSAKRTTYEELIFSL

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
10 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
11 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
12 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
15 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
18 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
21 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
24 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
25 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
26 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
27 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
28 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
29 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
30 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
31 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
32 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
33 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
34 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
38 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
39 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
40 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
41 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
42 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
43 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
44 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
45 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
46 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
47 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
48 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
51 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
52 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
53 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
54 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
55 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
56 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
57 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
58 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
59 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
60 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
61 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
62 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
63 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
66 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
67 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
68 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
69 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
70 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
71 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
72 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
73 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0
Isolates 5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 0
Rhizoplane 0
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0038296 3300035725 Bacteria 2848
2 rootH2_10246501 3300003320 Bacteria 1236
3 rootL2_10135592 3300003322 Bacteria 2174
4 rootL2_10366100 3300003322 Bacteria 1300
5 rootH1_10109977 3300003323 Bacteria 3906
6 Ga0070714_100026043 3300005435 Bacteria 4832
7 Ga0068855_100185701 3300005563 Bacteria 2348
8 Ga0081539_10051782 3300005985 Bacteria 2311
9 Ga0070717_10415226 3300006028 Bacteria 1210
10 Ga0068871_100763749 3300006358 Unclassified 889
11 Ga0105240_10147282 3300009093 Unclassified 2808
12 Ga0105245_10138631 3300009098 Bacteria 2289
13 Ga0105247_10471718 3300009101 Bacteria 909
14 Ga0105239_10362327 3300010375 Bacteria 1637
15 Ga0157380_11469974 3300014326 Bacteria 734
16 Ga0157379_10164217 3300014968 Bacteria 2004
17 Ga0213876_10271385 3300021384 Bacteria 902
18 Ga0209675_1000970 3300025291 Bacteria 18131
19 Ga0209675_1001303 3300025291 Bacteria 14810
20 Ga0209676_1017717 3300025292 Bacteria 2510
21 Ga0209050_1044298 3300025298 Bacteria 1192
22 Ga0209256_1088649 3300025299 Bacteria 662
23 Ga0207695_10235092 3300025913 Unclassified 1735
24 Ga0207664_10094232 3300025929 Bacteria 2460
25 Ga0265319_1002609 3300028563 Bacteria 9715
26 Ga0265319_1012170 3300028563 Bacteria 3488
27 Ga0265334_10001705 3300028573 Bacteria 10495
28 Ga0265318_10000058 3300028577 Bacteria 111153
29 Ga0265318_10000492 3300028577 Bacteria 28916
30 Ga0265338_10010306 3300028800 Bacteria 10984
31 Ga0265338_10381104 3300028800 Bacteria 1008
32 Ga0265324_10146620 3300029957 Bacteria 801
33 Ga0265332_10052222 3300031238 Bacteria 1755
34 Ga0265320_10000463 3300031240 Bacteria 31763
35 Ga0265320_10025186 3300031240 Bacteria 3132
36 Ga0265325_10004868 3300031241 Bacteria 8391
37 Ga0265325_10078741 3300031241 Bacteria 1641
38 Ga0265329_10000140 3300031242 Bacteria 34889
39 Ga0265340_10081673 3300031247 Bacteria 1521
40 Ga0265340_10210791 3300031247 Bacteria 872
41 Ga0265340_10282735 3300031247 Bacteria 737
42 Ga0265339_10010306 3300031249 Bacteria 5813
43 Ga0265339_10061285 3300031249 Bacteria 2025
44 Ga0265331_10000131 3300031250 Bacteria 98518
45 Ga0265331_10035426 3300031250 Bacteria 2456
46 Ga0265331_10088321 3300031250 Bacteria 1434
47 Ga0265327_10000163 3300031251 Bacteria 143328
48 Ga0265327_10001977 3300031251 Bacteria 23329
49 Ga0265316_10003137 3300031344 Bacteria 16830
50 Ga0265316_10067246 3300031344 Bacteria 2771
51 Ga0265316_10545371 3300031344 Bacteria 826
52 Ga0265313_10002521 3300031595 Bacteria 15732
53 Ga0265313_10003586 3300031595 Bacteria 12480
54 Ga0265314_10002509 3300031711 Bacteria 18724
55 Ga0265314_10010335 3300031711 Bacteria 7795
56 Ga0265314_10032192 3300031711 Bacteria 3859
57 Ga0265342_10000910 3300031712 Bacteria 29431
58 Ga0316583_10007264 3300032133 Bacteria 3988
59 Ga0373936_0042883 3300035113 Bacteria 1817
60 Ga0373953_0018597 3300035117 Bacteria 2573
61 Ga0373957_0012867 3300035120 Bacteria 2826
62 Ga0373937_0001940 3300036401 Bacteria 17308
63 Ga0316584_0024194 3300036712 Bacteria 4443
64 Ga0436365_1405909 3300039437 Unclassified 2386
65 Ga0436362_1222839 3300039453 Bacteria 607
66 Ga0451577_0008751 3300042876 Bacteria 9813
67 Ga0451577_0065776 3300042876 Bacteria 3233
68 Ga0453683_0697839 3300044673 Bacteria 665
69 Ga0451576_0000209 3300045051 Bacteria 147227
70 Ga0451576_0000247 3300045051 Bacteria 132668
71 Ga0451576_0294375 3300045051 Bacteria 1697
72 Ga0451576_0586436 3300045051 Bacteria 1172
73 Ga0495592_0234042 3300046454 Unclassified 1222
74 Ga0495651_0001436 3300046462 Bacteria 18452
75 Ga0495653_0562849 3300046463 Bacteria 704
76 Ga0495639_0184385 3300046475 Bacteria 1017
77 Ga0495608_0171085 3300046511 Bacteria 1378
78 Ga0495667_0059780 3300046559 Bacteria 2501
79 Ga0495599_0600801 3300046678 Bacteria 641
80 Ga0495604_0176085 3300047317 Bacteria 1500
81 Ga0495680_0000639 3300047322 Bacteria 39236
82 Ga0495675_0008031 3300047444 Bacteria 6531
83 Ga0495602_0223650 3300048088 Bacteria 1419
84 Ga0496125_0215814 3300048928 Bacteria 1241
85 Ga0501034_0441993 3300049571 Bacteria 1219
86 Ga0501034_0718958 3300049571 Bacteria 896
87 Ga0501047_0364702 3300049581 Bacteria 1280
88 Ga0501080_0092322 3300049742 Bacteria 2812
89 Ga0501044_0148766 3300049823 Bacteria 2325
90 Ga0495601_0314246 3300053077 Unclassified 1020
91 Ga0495612_0006666 3300053078 Bacteria 4737
92 Ga0495612_0121738 3300053078 Bacteria 1123
93 Ga0500622_0121689 3300053156 Bacteria 1265
94 Ga0501082_0527456 3300060353 Bacteria 1032
95 2523466241 2523231067 Bacteria 5230452
96 2523470170 2523231067 Bacteria 5230452
97 2739347037 2738543031 Bacteria 5769731
98 2739351466 2738543031 Bacteria 5769731
99 2883358447 2883354860 Bacteria 5865246
100 Ga0373947_0038296
101 rootH2_10246501
102 rootL2_10135592
103 rootL2_10366100
104 rootH1_10109977
105 Ga0070714_100026043
106 Ga0068855_100185701
107 Ga0081539_10051782
108 Ga0070717_10415226
109 Ga0068871_100763749
110 Ga0105240_10147282
111 Ga0105245_10138631
112 Ga0105247_10471718
113 Ga0105239_10362327
114 Ga0157380_11469974
115 Ga0157379_10164217
116 Ga0213876_10271385
117 Ga0209675_1000970
118 Ga0209675_1001303
119 Ga0209676_1017717
120 Ga0209050_1044298
121 Ga0209256_1088649
122 Ga0207695_10235092
123 Ga0207664_10094232
124 Ga0265319_1002609
125 Ga0265319_1012170
126 Ga0265334_10001705
127 Ga0265318_10000058
128 Ga0265318_10000492
129 Ga0265338_10010306
130 Ga0265338_10381104
131 Ga0265324_10146620
132 Ga0265332_10052222
133 Ga0265320_10000463
134 Ga0265320_10025186
135 Ga0265325_10004868
136 Ga0265325_10078741
137 Ga0265329_10000140
138 Ga0265340_10081673
139 Ga0265340_10210791
140 Ga0265340_10282735
141 Ga0265339_10010306
142 Ga0265339_10061285
143 Ga0265331_10000131
144 Ga0265331_10035426
145 Ga0265331_10088321
146 Ga0265327_10000163
147 Ga0265327_10001977
148 Ga0265316_10003137
149 Ga0265316_10067246
150 Ga0265316_10545371
151 Ga0265313_10002521
152 Ga0265313_10003586
153 Ga0265314_10002509
154 Ga0265314_10010335
155 Ga0265314_10032192
156 Ga0265342_10000910
157 Ga0316583_10007264
158 Ga0373936_0042883
159 Ga0373953_0018597
160 Ga0373957_0012867
161 Ga0373937_0001940
162 Ga0316584_0024194
163 Ga0436365_1405909
164 Ga0436362_1222839
165 Ga0451577_0008751
166 Ga0451577_0065776
167 Ga0453683_0697839
168 Ga0451576_0000209
169 Ga0451576_0000247
170 Ga0451576_0294375
171 Ga0451576_0586436
172 Ga0495592_0234042
173 Ga0495651_0001436
174 Ga0495653_0562849
175 Ga0495639_0184385
176 Ga0495608_0171085
177 Ga0495667_0059780
178 Ga0495599_0600801
179 Ga0495604_0176085
180 Ga0495680_0000639
181 Ga0495675_0008031
182 Ga0495602_0223650
183 Ga0496125_0215814
184 Ga0501034_0441993
185 Ga0501034_0718958
186 Ga0501047_0364702
187 Ga0501080_0092322
188 Ga0501044_0148766
189 Ga0495601_0314246
190 Ga0495612_0006666
191 Ga0495612_0121738
192 Ga0500622_0121689
193 Ga0501082_0527456
194 2523466241
195 2523470170
196 2739347037
197 2739351466
198 2883358447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08447

PAS_3

PAS fold

66

152

0.96

PF00989

PAS

PAS fold

54

151

0.94

PF08448

PAS_4

PAS fold

51

151

0.9

PF13426

PAS_9

PAS domain

53

151

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dik-assembly2.cif.gz_B redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9855 19 130
8dik-assembly1.cif.gz_A redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9737 7 132
8dik-assembly2.cif.gz_B redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9683 19 130
8dik-assembly1.cif.gz_A redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9514 7 132
4kuo-assembly1.cif.gz_A-2 a superfast recovering full-length lov protein from the marine phototrophic bacterium dinoroseobacter shibae (photoexcited state) 0.9278 18 119
ID Description Score Start End Superfamily
3ewkA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9618 20 116 3.30.450.20
af_P50466_15_144_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9513 14 143 3.30.450.20
af_Q76KC5_144_256_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.947 18 116 3.30.450.20
2gj3B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9306 18 120 3.30.450.20
af_P50466_15_144_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9225 14 143 3.30.450.20
ID Description Score Start End GO Terms
AF-F3GD59-F1-model_v4 PAS protein 0.9964 6 130 GO:0006935
GO:0007165
GO:0016020
AF-A0A7C3P8B4-F1-model_v4 PAS domain S-box protein 0.9961 1 134
AF-A0A656GPK1-F1-model_v4 deleted 0.9956 6 130
AF-A0A0N8QW84-F1-model_v4 deleted 0.9956 6 130
AF-F3IJY0-F1-model_v4 deleted 0.9955 6 130

Map