F005149

General Info

Members Datasets Scaffolds Average Seq Length
100 89 200 282

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000015|Ga0496104_0000015_145636_146583
Length 315
Sequence MDMASEVIGGHGRVGVNYRPHVPRRAAVCSGMQRQDLDFNVNGDACAAWFYPAAASGPSPIVVMAHGLSGTRRDGLGPFAERFAAAGIAALLFDHRGFGDSDGAPDRFEPRRQLEDWGAAIETARALPGIDAGRVATFGSSMGGGNALAAAVADPAVAAVVSQVPFLDIWTQAHRSGPGVGARMLAATVRGRHLPAVGQPHESAFINAPDAEAGWRHVVAIGEDSRWRNRVSSRWLLGRPFRPGRLAARLHCPWLVCVGEADRVARPGPAIAAARRAPRSELHTYPGVDHFDIYDGPEFEAVVADEIEFLTRHLL

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
50 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
51 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
52 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
53 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
56 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
57 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
58 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
59 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
62 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
63 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
64 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
65 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
68 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
69 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
70 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
71 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
72 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
73 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
85 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
86 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
87 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
88 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
89 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 14
Rhizosphere 81
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0000015 3300048907 Bacteria 374530
2 Ga0070683_100052069 3300005329 Bacteria 3792
3 Ga0070666_10029084 3300005335 Bacteria 3631
4 Ga0070691_10000002 3300005341 Bacteria 90686
5 Ga0070691_10003169 3300005341 Bacteria 7364
6 Ga0070674_100000299 3300005356 Bacteria 24346
7 Ga0070667_100219033 3300005367 Bacteria 1694
8 Ga0068867_100005476 3300005459 Bacteria 8983
9 Ga0070707_100074431 3300005468 Bacteria 3275
10 Ga0070702_100265292 3300005615 Unclassified 1171
11 Ga0068864_100000090 3300005618 Bacteria 96213
12 Ga0068866_10001920 3300005718 Bacteria 8683
13 Ga0068866_10015274 3300005718 Bacteria 3408
14 Ga0068861_100144083 3300005719 Bacteria 1948
15 Ga0068858_100000065 3300005842 Bacteria 108233
16 Ga0081540_1000006 3300005983 Bacteria 208724
17 Ga0070716_100134807 3300006173 Bacteria 1566
18 Ga0075428_100508241 3300006844 Bacteria 1289
19 Ga0105247_10001118 3300009101 Bacteria 19991
20 Ga0105242_10000059 3300009176 Bacteria 75563
21 Ga0105249_10165574 3300009553 Bacteria 2140
22 Ga0105246_10044904 3300011119 Bacteria 3006
23 Ga0157370_10004542 3300013104 Bacteria 15899
24 Ga0157374_10005364 3300013296 Bacteria 10771
25 Ga0157378_10043543 3300013297 Bacteria 3986
26 Ga0157375_10000668 3300013308 Bacteria 30338
27 Ga0163161_10057205 3300017792 Bacteria 2833
28 Ga0207642_10001031 3300025899 Bacteria 8670
29 Ga0207642_10014387 3300025899 Bacteria 2919
30 Ga0207710_10000451 3300025900 Bacteria 26569
31 Ga0207680_10004019 3300025903 Bacteria 6949
32 Ga0207705_10023847 3300025909 Unclassified 4366
33 Ga0207686_10000116 3300025934 Bacteria 64638
34 Ga0207669_10000257 3300025937 Bacteria 24346
35 Ga0207665_10056277 3300025939 Bacteria 2654
36 Ga0207661_10003275 3300025944 Bacteria 11234
37 Ga0207703_10000018 3300026035 Bacteria 271377
38 Ga0207648_10010079 3300026089 Bacteria 8985
39 Ga0207676_10000016 3300026095 Bacteria 311561
40 Ga0207675_100158829 3300026118 Bacteria 2155
41 Ga0265337_1019562 3300028556 Bacteria 2131
42 Ga0265326_10023010 3300028558 Bacteria 1782
43 Ga0265319_1000014 3300028563 Bacteria 177623
44 Ga0265319_1000875 3300028563 Bacteria 19169
45 Ga0265336_10000153 3300028666 Bacteria 49150
46 Ga0265338_10000244 3300028800 Bacteria 100528
47 Ga0265338_10000935 3300028800 Bacteria 49248
48 Ga0265324_10011511 3300029957 Bacteria 3368
49 Ga0265325_10034176 3300031241 Bacteria 2707
50 Ga0265340_10000066 3300031247 Bacteria 49153
51 Ga0265339_10054430 3300031249 Bacteria 2173
52 Ga0265331_10032062 3300031250 Bacteria 2606
53 Ga0265316_10060031 3300031344 Bacteria 2956
54 Ga0495603_0001505 3300046455 Bacteria 13589
55 Ga0495629_0001620 3300046459 Bacteria 17689
56 Ga0495629_0013238 3300046459 Bacteria 5956
57 Ga0495641_0014932 3300046461 Bacteria 4181
58 Ga0495650_0000012 3300046471 Bacteria 613144
59 Ga0495662_0000051 3300046476 Bacteria 40340
60 Ga0495594_0000032 3300046499 Bacteria 63783
61 Ga0495608_0009930 3300046511 Bacteria 6646
62 Ga0495628_0010925 3300046516 Bacteria 7690
63 Ga0495628_0120551 3300046516 Bacteria 2013
64 Ga0495630_0000020 3300046517 Bacteria 176389
65 Ga0495630_0136585 3300046517 Bacteria 1863
66 Ga0495630_0371919 3300046517 Bacteria 1094
67 Ga0495652_0000010 3300046529 Bacteria 261584
68 Ga0495640_0004202 3300046533 Bacteria 11520
69 Ga0495622_0000014 3300046557 Bacteria 182142
70 Ga0495668_0038566 3300046616 Bacteria 2669
71 Ga0495634_0002178 3300046642 Bacteria 16467
72 Ga0495647_0001340 3300046681 Bacteria 7584
73 Ga0495647_0003737 3300046681 Bacteria 4890
74 Ga0495613_0018610 3300046689 Bacteria 5179
75 Ga0495670_0021967 3300046691 Bacteria 3150
76 Ga0495674_0000010 3300047319 Bacteria 285794
77 Ga0495676_0000186 3300047321 Bacteria 49054
78 Ga0495680_0016128 3300047322 Bacteria 6424
79 Ga0496100_0000001 3300048903 Bacteria 530179
80 Ga0496101_0000004 3300048904 Bacteria 331599
81 Ga0496102_0000294 3300048905 Bacteria 64001
82 Ga0496103_0000159 3300048906 Bacteria 71148
83 Ga0496105_0000004 3300048908 Bacteria 475798
84 Ga0496106_0000056 3300048909 Bacteria 90682
85 Ga0496107_0000005 3300048910 Bacteria 281747
86 Ga0496108_0149279 3300048911 Bacteria 2016
87 Ga0496110_0010673 3300048913 Bacteria 7480
88 Ga0496111_0218280 3300048914 Bacteria 1416
89 Ga0496113_0018687 3300048916 Bacteria 4832
90 Ga0496114_0119226 3300048917 Bacteria 2268
91 Ga0496115_0000011 3300048918 Bacteria 222529
92 Ga0496119_0009550 3300048922 Bacteria 8303
93 Ga0496119_0051987 3300048922 Bacteria 2513
94 Ga0501042_0052635 3300049578 Bacteria 2904
95 Ga0495601_0028216 3300053077 Bacteria 3475
96 Ga0495655_0000002 3300053083 Bacteria 312752
97 Ga0495619_0000025 3300053085 Bacteria 167905
98 Ga0500566_0056198 3300053094 Bacteria 2239
99 Ga0500650_0111781 3300053098 Bacteria 1275
100 Ga0500628_000001 3300053129 Bacteria 564074
101 Ga0496104_0000015
102 Ga0070683_100052069
103 Ga0070666_10029084
104 Ga0070691_10000002
105 Ga0070691_10003169
106 Ga0070674_100000299
107 Ga0070667_100219033
108 Ga0068867_100005476
109 Ga0070707_100074431
110 Ga0070702_100265292
111 Ga0068864_100000090
112 Ga0068866_10001920
113 Ga0068866_10015274
114 Ga0068861_100144083
115 Ga0068858_100000065
116 Ga0081540_1000006
117 Ga0070716_100134807
118 Ga0075428_100508241
119 Ga0105247_10001118
120 Ga0105242_10000059
121 Ga0105249_10165574
122 Ga0105246_10044904
123 Ga0157370_10004542
124 Ga0157374_10005364
125 Ga0157378_10043543
126 Ga0157375_10000668
127 Ga0163161_10057205
128 Ga0207642_10001031
129 Ga0207642_10014387
130 Ga0207710_10000451
131 Ga0207680_10004019
132 Ga0207705_10023847
133 Ga0207686_10000116
134 Ga0207669_10000257
135 Ga0207665_10056277
136 Ga0207661_10003275
137 Ga0207703_10000018
138 Ga0207648_10010079
139 Ga0207676_10000016
140 Ga0207675_100158829
141 Ga0265337_1019562
142 Ga0265326_10023010
143 Ga0265319_1000014
144 Ga0265319_1000875
145 Ga0265336_10000153
146 Ga0265338_10000244
147 Ga0265338_10000935
148 Ga0265324_10011511
149 Ga0265325_10034176
150 Ga0265340_10000066
151 Ga0265339_10054430
152 Ga0265331_10032062
153 Ga0265316_10060031
154 Ga0495603_0001505
155 Ga0495629_0001620
156 Ga0495629_0013238
157 Ga0495641_0014932
158 Ga0495650_0000012
159 Ga0495662_0000051
160 Ga0495594_0000032
161 Ga0495608_0009930
162 Ga0495628_0010925
163 Ga0495628_0120551
164 Ga0495630_0000020
165 Ga0495630_0136585
166 Ga0495630_0371919
167 Ga0495652_0000010
168 Ga0495640_0004202
169 Ga0495622_0000014
170 Ga0495668_0038566
171 Ga0495634_0002178
172 Ga0495647_0001340
173 Ga0495647_0003737
174 Ga0495613_0018610
175 Ga0495670_0021967
176 Ga0495674_0000010
177 Ga0495676_0000186
178 Ga0495680_0016128
179 Ga0496100_0000001
180 Ga0496101_0000004
181 Ga0496102_0000294
182 Ga0496103_0000159
183 Ga0496105_0000004
184 Ga0496106_0000056
185 Ga0496107_0000005
186 Ga0496108_0149279
187 Ga0496110_0010673
188 Ga0496111_0218280
189 Ga0496113_0018687
190 Ga0496114_0119226
191 Ga0496115_0000011
192 Ga0496119_0009550
193 Ga0496119_0051987
194 Ga0501042_0052635
195 Ga0495601_0028216
196 Ga0495655_0000002
197 Ga0495619_0000025
198 Ga0500566_0056198
199 Ga0500650_0111781
200 Ga0500628_000001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05448

AXE1

Acetyl xylan esterase (AXE1)

104

176

0.9

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

297

0.89

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

46

278

0.86

PF01738

DLH

Dienelactone hydrolase family

46

176

0.83

PF12146

Hydrolase_4

Serine aminopeptidase, S33

56

295

0.83

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

305

0.55

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.8299 2 283
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8223 2 279
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.8155 2 283
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8154 2 279
7q4j-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex a monoacylglycerol intermediate 0.8048 2 285
ID Description Score Start End Superfamily
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8499 2 282 3.40.50.1820
af_P9WLC7_41_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8319 3 276 3.40.50.1820
af_A0A0R0EWP2_30_290_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8234 2 90 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8213 3 90 3.40.50.12270
af_C0H4R4_26_229_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.819 6 260 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3D2BVG9-F1-model_v4 Alpha/beta hydrolase 0.9121 2 131 GO:0052689
AF-A0A3D2N8D8-F1-model_v4 deleted 0.9072 2 130
AF-W1UUJ3-F1-model_v4 deleted 0.9067 2 130
AF-A0A366JGN6-F1-model_v4 X-Pro dipeptidyl-peptidase-like protein 0.8885 1 132 GO:0052689
AF-A0A2M7U7G9-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.8877 4 131

Map