F009196

General Info

Members Datasets Scaffolds Average Seq Length
101 84 202 203

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10204003|Ga0163161_102040032
Length 233
Sequence VLGLLNGWYVPPALGGHARQASRHRLRAVFVAALASVLALAIAACGEESSSDANEAEGKYRVQVTDASFPSEQQLGQTYLLKLGVRNDGKRTIPALTVNVSIKGKEGEGSTLPFGIRDPQPELAQPDRPVWVLAAHYPKFAGDSAAGGAETSNQKTFDFGPLKKGATANAVWKLSAVKAGNYTIVYGVEAGLSDTTKAVTGNGIAPGGSFAVKISAAERDTEVNGSGEVVEKK

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
42 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
43 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
44 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
50 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
51 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
52 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
53 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
54 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
55 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
56 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
57 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
58 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
59 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
60 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
61 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
62 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
63 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
64 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
65 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
66 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
71 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
74 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
75 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
79 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
80 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
81 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
82 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
83 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
84 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 11.88
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 8.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10204003 3300017792 Bacteria 1525
2 Ga0070677_10000020 3300005333 Bacteria 48941
3 Ga0070691_10000003 3300005341 Bacteria 86538
4 Ga0070659_100281771 3300005366 Bacteria 1383
5 Ga0070701_10274120 3300005438 Bacteria 1028
6 Ga0070663_100134073 3300005455 Unclassified 1884
7 Ga0070663_100656941 3300005455 Bacteria 887
8 Ga0070662_100000001 3300005457 Bacteria 317995
9 Ga0070685_10168288 3300005466 Bacteria 1403
10 Ga0070684_100346642 3300005535 Bacteria 1366
11 Ga0068853_100008937 3300005539 Bacteria 8066
12 Ga0070665_100000022 3300005548 Bacteria 379286
13 Ga0068854_100058826 3300005578 Bacteria 2776
14 Ga0068856_100033916 3300005614 Bacteria 4999
15 Ga0068852_100199449 3300005616 Bacteria 1893
16 Ga0068863_100000050 3300005841 Bacteria 130200
17 Ga0068863_100223524 3300005841 Bacteria 1814
18 Ga0068858_100000763 3300005842 Bacteria 33724
19 Ga0070715_10000072 3300006163 Bacteria 30717
20 Ga0105245_10014841 3300009098 Bacteria 6785
21 Ga0105245_10357905 3300009098 Unclassified 1448
22 Ga0105238_10000016 3300009551 Bacteria 236218
23 Ga0105249_10000054 3300009553 Bacteria 162883
24 Ga0105239_10075743 3300010375 Bacteria 3700
25 Ga0157370_10035743 3300013104 Bacteria 4826
26 Ga0163162_10891320 3300013306 Bacteria 1003
27 Ga0157375_10091563 3300013308 Bacteria 3103
28 Ga0157375_10708656 3300013308 Unclassified 1160
29 Ga0157380_10018336 3300014326 Bacteria 5194
30 Ga0157379_10059862 3300014968 Bacteria 3406
31 Ga0207682_10000550 3300025893 Bacteria 17257
32 Ga0207685_10000073 3300025905 Bacteria 23848
33 Ga0207694_10000012 3300025924 Bacteria 411218
34 Ga0207687_10000109 3300025927 Bacteria 59406
35 Ga0207690_10243922 3300025932 Bacteria 1385
36 Ga0207706_10000003 3300025933 Bacteria 345011
37 Ga0207686_10000416 3300025934 Bacteria 29091
38 Ga0207661_10001090 3300025944 Bacteria 18024
39 Ga0207712_10000032 3300025961 Bacteria 210628
40 Ga0207640_10010014 3300025981 Bacteria 5324
41 Ga0207639_10004373 3300026041 Bacteria 9532
42 Ga0207702_10011226 3300026078 Bacteria 7469
43 Ga0207641_10000436 3300026088 Bacteria 47925
44 Ga0207641_10146200 3300026088 Bacteria 2137
45 Ga0207698_10165383 3300026142 Bacteria 1941
46 Ga0373933_0201080 3300035724 Bacteria 1275
47 Ga0373937_0020852 3300036401 Bacteria 5878
48 Ga0373937_0256918 3300036401 Bacteria 1647
49 Ga0451807_1729685 3300041486 Bacteria 1521
50 Ga0451849_0195264 3300041505 Bacteria 2493
51 Ga0451849_0330997 3300041505 Bacteria 1042
52 Ga0466963_0000033 3300044694 Bacteria 45230
53 Ga0466967_0069493 3300045976 Bacteria 3148
54 Ga0466967_0581232 3300045976 Unclassified 1104
55 Ga0495603_0006746 3300046455 Bacteria 6889
56 Ga0495629_0001594 3300046459 Bacteria 17849
57 Ga0495641_0000010 3300046461 Bacteria 158798
58 Ga0495608_0004170 3300046511 Bacteria 10366
59 Ga0495608_0091430 3300046511 Bacteria 1968
60 Ga0495620_0001864 3300046515 Bacteria 12408
61 Ga0495644_0000869 3300046523 Bacteria 12494
62 Ga0495586_0000363 3300046535 Bacteria 28122
63 Ga0495598_0000575 3300046537 Bacteria 6916
64 Ga0495621_0002893 3300046539 Bacteria 4677
65 Ga0495645_0094000 3300046543 Bacteria 2139
66 Ga0495645_0196231 3300046543 Bacteria 1372
67 Ga0495599_0004290 3300046678 Bacteria 8432
68 Ga0495623_0083153 3300046679 Bacteria 1978
69 Ga0495658_0000001 3300046683 Bacteria 385362
70 Ga0495669_0000420 3300046684 Bacteria 20393
71 Ga0495624_0000005 3300046690 Bacteria 158127
72 Ga0495600_0400509 3300046809 Unclassified 854
73 Ga0495676_0035371 3300047321 Bacteria 4179
74 Ga0495680_0042253 3300047322 Bacteria 3619
75 Ga0495680_0157398 3300047322 Unclassified 1652
76 Ga0495680_0297993 3300047322 Bacteria 1133
77 Ga0495602_0091208 3300048088 Bacteria 2528
78 Ga0495602_0480037 3300048088 Bacteria 872
79 Ga0496101_0000009 3300048904 Bacteria 297429
80 Ga0496104_0000008 3300048907 Bacteria 516976
81 Ga0496105_0000002 3300048908 Bacteria 753215
82 Ga0496105_0000003 3300048908 Bacteria 713251
83 Ga0496106_0000072 3300048909 Bacteria 80978
84 Ga0496106_0000107 3300048909 Bacteria 64689
85 Ga0496107_0000015 3300048910 Bacteria 173644
86 Ga0496107_0129702 3300048910 Unclassified 1861
87 Ga0496111_0575442 3300048914 Bacteria 826
88 Ga0496112_0334049 3300048915 Bacteria 1459
89 Ga0496115_0000036 3300048918 Bacteria 127774
90 Ga0496119_0045806 3300048922 Bacteria 2738
91 Ga0496120_0033750 3300048923 Bacteria 3072
92 Ga0501039_0228538 3300049575 Unclassified 1463
93 Ga0501040_0575756 3300049576 Unclassified 813
94 Ga0501072_0156478 3300049588 Bacteria 1817
95 Ga0501081_0099794 3300049743 Bacteria 2051
96 Ga0495601_0000221 3300053077 Bacteria 30508
97 Ga0495601_0158898 3300053077 Bacteria 1477
98 Ga0495612_0000710 3300053078 Bacteria 13507
99 Ga0495619_0007295 3300053085 Bacteria 7002
100 Ga0500566_0001814 3300053094 Bacteria 12548
101 Ga0500614_000473 3300053123 Bacteria 10420
102 Ga0163161_10204003
103 Ga0070677_10000020
104 Ga0070691_10000003
105 Ga0070659_100281771
106 Ga0070701_10274120
107 Ga0070663_100134073
108 Ga0070663_100656941
109 Ga0070662_100000001
110 Ga0070685_10168288
111 Ga0070684_100346642
112 Ga0068853_100008937
113 Ga0070665_100000022
114 Ga0068854_100058826
115 Ga0068856_100033916
116 Ga0068852_100199449
117 Ga0068863_100000050
118 Ga0068863_100223524
119 Ga0068858_100000763
120 Ga0070715_10000072
121 Ga0105245_10014841
122 Ga0105245_10357905
123 Ga0105238_10000016
124 Ga0105249_10000054
125 Ga0105239_10075743
126 Ga0157370_10035743
127 Ga0163162_10891320
128 Ga0157375_10091563
129 Ga0157375_10708656
130 Ga0157380_10018336
131 Ga0157379_10059862
132 Ga0207682_10000550
133 Ga0207685_10000073
134 Ga0207694_10000012
135 Ga0207687_10000109
136 Ga0207690_10243922
137 Ga0207706_10000003
138 Ga0207686_10000416
139 Ga0207661_10001090
140 Ga0207712_10000032
141 Ga0207640_10010014
142 Ga0207639_10004373
143 Ga0207702_10011226
144 Ga0207641_10000436
145 Ga0207641_10146200
146 Ga0207698_10165383
147 Ga0373933_0201080
148 Ga0373937_0020852
149 Ga0373937_0256918
150 Ga0451807_1729685
151 Ga0451849_0195264
152 Ga0451849_0330997
153 Ga0466963_0000033
154 Ga0466967_0069493
155 Ga0466967_0581232
156 Ga0495603_0006746
157 Ga0495629_0001594
158 Ga0495641_0000010
159 Ga0495608_0004170
160 Ga0495608_0091430
161 Ga0495620_0001864
162 Ga0495644_0000869
163 Ga0495586_0000363
164 Ga0495598_0000575
165 Ga0495621_0002893
166 Ga0495645_0094000
167 Ga0495645_0196231
168 Ga0495599_0004290
169 Ga0495623_0083153
170 Ga0495658_0000001
171 Ga0495669_0000420
172 Ga0495624_0000005
173 Ga0495600_0400509
174 Ga0495676_0035371
175 Ga0495680_0042253
176 Ga0495680_0157398
177 Ga0495680_0297993
178 Ga0495602_0091208
179 Ga0495602_0480037
180 Ga0496101_0000009
181 Ga0496104_0000008
182 Ga0496105_0000002
183 Ga0496105_0000003
184 Ga0496106_0000072
185 Ga0496106_0000107
186 Ga0496107_0000015
187 Ga0496107_0129702
188 Ga0496111_0575442
189 Ga0496112_0334049
190 Ga0496115_0000036
191 Ga0496119_0045806
192 Ga0496120_0033750
193 Ga0501039_0228538
194 Ga0501040_0575756
195 Ga0501072_0156478
196 Ga0501081_0099794
197 Ga0495601_0000221
198 Ga0495601_0158898
199 Ga0495612_0000710
200 Ga0495619_0007295
201 Ga0500566_0001814
202 Ga0500614_000473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3idu-assembly2.cif.gz_B crystal structure of the cardb domain of the pf1109 protein in complex with di-metal ions from pyrococcus furiosus, northeast structural genomics consortium target pfr193a 0.7972 36 190
5mhl-assembly1.cif.gz_A fxiiia in complex with the inhibitor mi0621 0.7868 37 191
8cte-assembly1.cif.gz_X class 2 of erythrocyte ankyrin-1 complex (composite map) 0.7864 36 194
2m8x-assembly1.cif.gz_A restrained cs-rosetta solution nmr structure of the cardb domain of pf1109 from pyrococcus furiosus. northeast structural genomics consortium target pfr193a 0.7764 36 194
7tw1-assembly1.cif.gz_E cryo-em structure of human band 3-protein 4.2 complex (b2p2vertical) 0.7718 36 194
ID Description Score Start End Superfamily
af_P49222_590_685_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7892 42 191 2.60.40.10
af_Q99041_572_665_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7885 42 190 2.60.40.10
af_Q8ILG6_1103_1206_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7834 38 164 2.60.40.1230
2m8xA00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7764 36 194 2.60.40.10
af_P49222_590_685_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7745 42 191 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A537ZX67-F1-model_v4 Uncharacterized protein 0.8701 39 206
AF-A0A838V4D6-F1-model_v4 DUF4232 domain-containing protein 0.8384 13 209 GO:0005975
AF-A0A1Q3NDR7-F1-model_v4 deleted 0.838 14 207
AF-A0A538A0W5-F1-model_v4 Uncharacterized protein 0.8292 14 206
AF-A0A2V2EPM2-F1-model_v4 CARDB domain-containing protein 0.8267 36 194 GO:0016020

Map