F015698

General Info

Members Datasets Scaffolds Average Seq Length
102 44 204 294

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10000241|Ga0316579_100002414
Length 348
Sequence VSKLLSPKVLVPTLVLIVGLVIINVVFTIPGVVLPEISIAAEPVFDVTLGGFWPNGITNTLLASWLTTAILVVGIWAITRKTREVPRRWQGALEMVIEGMYNLVEGAAGRKWARRFFPIVMTIFLFVITASWLGLTPLFGSWGALHHAEHGEPVQWLNDAHTVGLWVPADESQEAEAYSSEEEAHPGEGEVYTLAPMFRAATTDLNVTLALALVSVVLTQYFGLSALGIGYLSKFINVGGFVKAFTKRGIGCMGRVAAFGMGIIDFFIGIVELISEIGKIISFSFRLFGNIFAGEVLLGVMAFLIPYLVSLPFYGLELFVGFVQALVFMMLSVAFFIVATTTHGEEGH

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
18 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
19 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
20 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
21 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
22 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
23 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
24 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
25 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
26 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
27 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
28 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
29 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
30 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
31 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
33 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
34 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
35 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
36 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
37 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
38 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
41 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
42 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
43 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
44 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10000241 3300031691 Bacteria 16729
2 Ga0070680_100004833 3300005336 Bacteria 10144
3 Ga0070680_100006567 3300005336 Bacteria 8847
4 Ga0070682_100279245 3300005337 Bacteria 1217
5 Ga0070681_10106866 3300005458 Bacteria 2740
6 Ga0070685_10264411 3300005466 Bacteria 1145
7 Ga0070679_100001689 3300005530 Bacteria 19878
8 Ga0070679_100032178 3300005530 Bacteria 5186
9 Ga0070704_100000005 3300005549 Bacteria 112444
10 Ga0070704_100022890 3300005549 Bacteria 4072
11 Ga0068856_100008301 3300005614 Bacteria 10122
12 Ga0068863_100016972 3300005841 Bacteria 6982
13 Ga0114129_10105907 3300009147 Bacteria 3885
14 Ga0207707_10113980 3300025912 Bacteria 2363
15 Ga0207660_10006186 3300025917 Bacteria 7777
16 Ga0207652_10035146 3300025921 Bacteria 4228
17 Ga0207652_10113254 3300025921 Bacteria 2408
18 Ga0207702_10011739 3300026078 Bacteria 7296
19 Ga0207641_10012340 3300026088 Bacteria 7011
20 Ga0207676_10296707 3300026095 Bacteria 1474
21 Ga0265336_10009643 3300028666 Bacteria 3331
22 Ga0265338_10025450 3300028800 Bacteria 6003
23 Ga0265320_10027661 3300031240 Bacteria 2954
24 Ga0265340_10000131 3300031247 Bacteria 37276
25 Ga0265331_10009388 3300031250 Bacteria 5492
26 Ga0265331_10079316 3300031250 Bacteria 1528
27 Ga0265327_10013698 3300031251 Bacteria 5366
28 Ga0265316_10328472 3300031344 Bacteria 1110
29 Ga0265313_10004960 3300031595 Bacteria 9959
30 Ga0316579_10014856 3300031691 Unclassified 3375
31 Ga0316579_10032408 3300031691 Unclassified 2397
32 Ga0265314_10001735 3300031711 Bacteria 23593
33 Ga0316576_10025030 3300031727 Unclassified 4175
34 Ga0316577_10000584 3300031733 Bacteria 14964
35 Ga0316577_10000730 3300031733 Bacteria 14009
36 Ga0316577_10001746 3300031733 Bacteria 10460
37 Ga0316577_10001929 3300031733 Bacteria 10046
38 Ga0316577_10043925 3300031733 Bacteria 2500
39 Ga0316577_10048213 3300031733 Bacteria 2379
40 Ga0316577_10128188 3300031733 Bacteria 1428
41 Ga0316577_10136574 3300031733 Bacteria 1381
42 Ga0307416_100919060 3300032002 Bacteria 976
43 Ga0316585_10049791 3300032137 Bacteria 1344
44 Ga0316580_10038319 3300032139 Bacteria 1482
45 Ga0316593_10019794 3300032168 Unclassified 2084
46 Ga0316574_0004274 3300035398 Bacteria 7462
47 Ga0316582_0000336 3300036647 Bacteria 16557
48 Ga0316582_0004726 3300036647 Bacteria 6933
49 Ga0316582_0010615 3300036647 Archaea 5053
50 Ga0316582_0023139 3300036647 Bacteria 3699
51 Ga0316582_0126291 3300036647 Bacteria 1715
52 Ga0316584_0000278 3300036712 Bacteria 26081
53 Ga0316584_0000895 3300036712 Bacteria 16968
54 Ga0316584_0001093 3300036712 Bacteria 15878
55 Ga0316584_0002187 3300036712 Bacteria 12253
56 Ga0316584_0050996 3300036712 Unclassified 3094
57 Ga0316584_0064170 3300036712 Bacteria 2750
58 Ga0316584_0079611 3300036712 Bacteria 2455
59 Ga0316581_0000174 3300037588 Bacteria 10460
60 Ga0316581_0075612 3300037588 Bacteria 1034
61 Ga0400491_28417 3300038727 Bacteria 31159
62 Ga0400489_18103 3300039093 Bacteria 4062
63 Ga0400489_23981 3300039093 Bacteria 41609
64 Ga0451849_0792182 3300041505 Unclassified 1837
65 Ga0451577_0000003 3300042876 Bacteria 921850
66 Ga0451577_0000056 3300042876 Bacteria 273200
67 Ga0451577_0024803 3300042876 Bacteria 5449
68 Ga0451577_0069527 3300042876 Bacteria 3140
69 Ga0451577_0241608 3300042876 Unclassified 1634
70 Ga0451577_0352002 3300042876 Unclassified 1336
71 Ga0453683_0000006 3300044673 Bacteria 586638
72 Ga0453683_0001340 3300044673 Bacteria 21578
73 Ga0453683_0059831 3300044673 Bacteria 2381
74 Ga0453684_0000009 3300044712 Bacteria 1139914
75 Ga0453684_0000018 3300044712 Bacteria 921850
76 Ga0453684_0000042 3300044712 Bacteria 682980
77 Ga0453684_0000777 3300044712 Bacteria 110019
78 Ga0453684_0001872 3300044712 Bacteria 54750
79 Ga0453684_0004229 3300044712 Bacteria 30759
80 Ga0453684_0014586 3300044712 Bacteria 12545
81 Ga0453684_0041939 3300044712 Bacteria 6177
82 Ga0453684_0118949 3300044712 Bacteria 3194
83 Ga0453684_0155006 3300044712 Unclassified 2717
84 Ga0453684_0167888 3300044712 Bacteria 2589
85 Ga0453684_0186321 3300044712 Bacteria 2432
86 Ga0453684_0697507 3300044712 Bacteria 1103
87 Ga0451576_0000243 3300045051 Bacteria 133634
88 Ga0451576_0000370 3300045051 Bacteria 106737
89 Ga0451576_0000437 3300045051 Bacteria 95694
90 Ga0451576_0003958 3300045051 Bacteria 19748
91 Ga0451576_0003965 3300045051 Bacteria 19712
92 Ga0451576_0004387 3300045051 Bacteria 18381
93 Ga0451576_0040937 3300045051 Bacteria 4899
94 Ga0451576_0048875 3300045051 Bacteria 4441
95 Ga0451576_0073703 3300045051 Unclassified 3553
96 Ga0451576_0108809 3300045051 Bacteria 2884
97 Ga0451576_0380218 3300045051 Bacteria 1480
98 Ga0451576_0383095 3300045051 Bacteria 1474
99 Ga0451576_0547598 3300045051 Bacteria 1215
100 Ga0451576_0594395 3300045051 Bacteria 1163
101 nmdc:mga05p37_88465_c1 3300050507 Bacteria 3817
102 Ga0500616_0000008 3300053153 Bacteria 785239
103 Ga0316579_10000241
104 Ga0070680_100004833
105 Ga0070680_100006567
106 Ga0070682_100279245
107 Ga0070681_10106866
108 Ga0070685_10264411
109 Ga0070679_100001689
110 Ga0070679_100032178
111 Ga0070704_100000005
112 Ga0070704_100022890
113 Ga0068856_100008301
114 Ga0068863_100016972
115 Ga0114129_10105907
116 Ga0207707_10113980
117 Ga0207660_10006186
118 Ga0207652_10035146
119 Ga0207652_10113254
120 Ga0207702_10011739
121 Ga0207641_10012340
122 Ga0207676_10296707
123 Ga0265336_10009643
124 Ga0265338_10025450
125 Ga0265320_10027661
126 Ga0265340_10000131
127 Ga0265331_10009388
128 Ga0265331_10079316
129 Ga0265327_10013698
130 Ga0265316_10328472
131 Ga0265313_10004960
132 Ga0316579_10014856
133 Ga0316579_10032408
134 Ga0265314_10001735
135 Ga0316576_10025030
136 Ga0316577_10000584
137 Ga0316577_10000730
138 Ga0316577_10001746
139 Ga0316577_10001929
140 Ga0316577_10043925
141 Ga0316577_10048213
142 Ga0316577_10128188
143 Ga0316577_10136574
144 Ga0307416_100919060
145 Ga0316585_10049791
146 Ga0316580_10038319
147 Ga0316593_10019794
148 Ga0316574_0004274
149 Ga0316582_0000336
150 Ga0316582_0004726
151 Ga0316582_0010615
152 Ga0316582_0023139
153 Ga0316582_0126291
154 Ga0316584_0000278
155 Ga0316584_0000895
156 Ga0316584_0001093
157 Ga0316584_0002187
158 Ga0316584_0050996
159 Ga0316584_0064170
160 Ga0316584_0079611
161 Ga0316581_0000174
162 Ga0316581_0075612
163 Ga0400491_28417
164 Ga0400489_18103
165 Ga0400489_23981
166 Ga0451849_0792182
167 Ga0451577_0000003
168 Ga0451577_0000056
169 Ga0451577_0024803
170 Ga0451577_0069527
171 Ga0451577_0241608
172 Ga0451577_0352002
173 Ga0453683_0000006
174 Ga0453683_0001340
175 Ga0453683_0059831
176 Ga0453684_0000009
177 Ga0453684_0000018
178 Ga0453684_0000042
179 Ga0453684_0000777
180 Ga0453684_0001872
181 Ga0453684_0004229
182 Ga0453684_0014586
183 Ga0453684_0041939
184 Ga0453684_0118949
185 Ga0453684_0155006
186 Ga0453684_0167888
187 Ga0453684_0186321
188 Ga0453684_0697507
189 Ga0451576_0000243
190 Ga0451576_0000370
191 Ga0451576_0000437
192 Ga0451576_0003958
193 Ga0451576_0003965
194 Ga0451576_0004387
195 Ga0451576_0040937
196 Ga0451576_0048875
197 Ga0451576_0073703
198 Ga0451576_0108809
199 Ga0451576_0380218
200 Ga0451576_0383095
201 Ga0451576_0547598
202 Ga0451576_0594395
203 nmdc:mga05p37_88465_c1
204 Ga0500616_0000008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

61

337

0.89

Map