F017378

General Info

Members Datasets Scaffolds Average Seq Length
102 83 204 171

Family's Representative Sequence

Representative Sequence 3300049704|Ga0501221_124727|Ga0501221_124727_65_646
Length 193
Sequence LPQDSSYSSISKKLKNDIMENLADKYSHIPGWGMDADPENEPTYPMKNYTGDDHNRLNYEPPPFQPQHEEILMSIERPRKSAVFGTSTPPSGLSGMIRRYAFKYSESSYGHWLPLIIADRINVVEGILEDLGRGRIPNIFAERGGKAALKHNPQAVARNVITAVLVVSAVSLLIYRNSDNKKSPKKLLRKAFA

Samples

Sample ID Description Type Environment
1 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
8 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
9 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
10 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
11 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
12 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
13 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
29 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
30 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
31 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
36 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
39 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
44 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
49 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
50 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
51 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
52 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
53 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
54 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
55 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
56 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
57 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
58 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
59 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
60 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
61 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
62 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
63 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
64 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
65 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
66 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
67 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
68 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
69 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
70 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
71 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
72 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
73 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
74 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
75 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
76 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
77 2739367663 Pedobacter sp. YR510 Isolate Unclassified
78 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
79 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
80 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
81 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
82 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
83 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.16
Metatranscriptomes 0.98
Isolates 6.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 0
Rhizoplane 1.96
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501221_124727 3300049704 Bacteria 661
2 rootL2_10078729 3300003322 Bacteria 3046
3 Ga0065715_10196446 3300005293 Bacteria 1385
4 Ga0070683_100000821 3300005329 Bacteria 23016
5 Ga0070707_100968299 3300005468 Bacteria 816
6 Ga0068852_100278442 3300005616 Bacteria 1612
7 Ga0075366_10000117 3300006195 Bacteria 32747
8 Ga0075370_10080382 3300006353 Bacteria 1873
9 Ga0075429_100078234 3300006880 Bacteria 2882
10 Ga0105240_10433373 3300009093 Unclassified 1475
11 Ga0105239_10005380 3300010375 Bacteria 15037
12 Ga0157373_10109216 3300013100 Unclassified 1945
13 Ga0157373_10613571 3300013100 Bacteria 793
14 Ga0157371_10148478 3300013102 Unclassified 1671
15 Ga0157370_10003006 3300013104 Bacteria 20011
16 Ga0157370_10019128 3300013104 Bacteria 6885
17 Ga0157370_10254434 3300013104 Bacteria 1624
18 Ga0157369_10080945 3300013105 Bacteria 3476
19 Ga0157369_10429345 3300013105 Bacteria 1369
20 Ga0157369_10787474 3300013105 Bacteria 977
21 Ga0163162_10000155 3300013306 Bacteria 63251
22 Ga0157372_10000009 3300013307 Bacteria 302051
23 Ga0157372_10076987 3300013307 Bacteria 3767
24 Ga0157372_10394755 3300013307 Bacteria 1612
25 Ga0157372_10922904 3300013307 Bacteria 1012
26 Ga0157372_10957899 3300013307 Bacteria 992
27 Ga0182008_10009057 3300014497 Bacteria 5390
28 Ga0182008_10061675 3300014497 Bacteria 1848
29 Ga0182006_1001115 3300015261 Bacteria 17101
30 Ga0182007_10007004 3300015262 Bacteria 4782
31 Ga0206351_10653920 3300020077 Bacteria 1311
32 Ga0209758_1039059 3300025297 Bacteria 1811
33 Ga0207695_10132078 3300025913 Unclassified 2453
34 Ga0207661_10001498 3300025944 Bacteria 15820
35 Ga0207667_10328407 3300025949 Bacteria 1562
36 Ga0207678_10003776 3300026067 Bacteria 13616
37 Ga0207678_11081812 3300026067 Bacteria 710
38 Ga0207698_10615156 3300026142 Bacteria 1072
39 Ga0307515_10000616 3300028794 Bacteria 83207
40 Ga0316181_1060546 3300030744 Bacteria 2008
41 Ga0307408_100001267 3300031548 Bacteria 18967
42 Ga0307405_10019444 3300031731 Bacteria 3773
43 Ga0307413_10385654 3300031824 Bacteria 1093
44 Ga0307412_10647891 3300031911 Bacteria 901
45 Ga0307416_100348665 3300032002 Bacteria 1497
46 Ga0307414_10294841 3300032004 Bacteria 1369
47 Ga0307414_11568114 3300032004 Unclassified 613
48 Ga0307411_10181814 3300032005 Bacteria 1597
49 Ga0307415_100308420 3300032126 Bacteria 1314
50 Ga0395899_0000220 3300037312 Bacteria 78900
51 Ga0395900_1171108 3300037418 Unclassified 684
52 Ga0395901_0405052 3300038443 Unclassified 1401
53 Ga0436365_0674884 3300039437 Bacteria 3134
54 Ga0439436_0021077 3300041404 Bacteria 1940
55 Ga0451793_1254190 3300041452 Bacteria 744
56 Ga0439449_0038840 3300042007 Bacteria 1769
57 Ga0466969_0030388 3300044656 Bacteria 2754
58 Ga0466966_0021956 3300044684 Bacteria 4190
59 Ga0466963_0658777 3300044694 Bacteria 739
60 Ga0495605_0331227 3300046474 Bacteria 641
61 Ga0495606_0126161 3300046507 Bacteria 1526
62 Ga0495625_0001400 3300046660 Bacteria 29555
63 Ga0495661_0001645 3300046665 Bacteria 18216
64 Ga0495686_0000274 3300047472 Bacteria 91650
65 Ga0495686_0333589 3300047472 Bacteria 828
66 Ga0496115_0066884 3300048918 Bacteria 2905
67 Ga0501198_001324 3300049649 Bacteria 3210
68 Ga0501201_000860 3300049651 Bacteria 2845
69 Ga0501202_000257 3300049652 Bacteria 7122
70 Ga0501202_081145 3300049652 Bacteria 762
71 Ga0501206_000380 3300049653 Bacteria 5269
72 Ga0501207_002249 3300049654 Bacteria 2476
73 Ga0501217_015546 3300049661 Bacteria 1734
74 Ga0501217_040254 3300049661 Bacteria 1187
75 Ga0501222_000711 3300049662 Bacteria 4857
76 Ga0501223_000735 3300049663 Bacteria 7803
77 Ga0501223_018177 3300049663 Bacteria 1383
78 Ga0501224_001069 3300049664 Bacteria 3564
79 Ga0501235_002706 3300049669 Bacteria 3810
80 Ga0501240_005415 3300049673 Bacteria 1527
81 Ga0501221_003438 3300049704 Bacteria 2603
82 Ga0501225_0001890 3300049705 Bacteria 6583
83 Ga0501225_0068258 3300049705 Bacteria 1008
84 Ga0501234_010346 3300049707 Bacteria 1453
85 Ga0501245_000258 3300049708 Bacteria 6127
86 Ga0501241_000811 3300049758 Bacteria 6646
87 Ga0501241_013645 3300049758 Unclassified 1476
88 Ga0501264_002459 3300049761 Bacteria 1727
89 Ga0501280_002948 3300049776 Bacteria 2711
90 nmdc:mga0k408_49_c2 3300050493 Bacteria 55012
91 nmdc:mga09592_115047_c1 3300050508 Bacteria 2309
92 nmdc:mga0qj67_119630_c1 3300050509 Bacteria 2130
93 nmdc:mga06r32_444421_c1 3300050510 Bacteria 1277
94 Ga0500622_0000003 3300053156 Bacteria 613483
95 Ga0466962_0099846 3300061719 Bacteria 1393
96 2739648356 2739367663 Bacteria 5040914
97 2857629441 2857627736 Bacteria 5625397
98 2885431046 2885429604 Bacteria 3642894
99 2929242407 2929239360 Bacteria 7745570
100 2945999838 2945997725 Bacteria 6404843
101 2977246814 2977243572 Bacteria 4374394
102 2993483671 2993480792 Bacteria 4022225
103 Ga0501221_124727
104 rootL2_10078729
105 Ga0065715_10196446
106 Ga0070683_100000821
107 Ga0070707_100968299
108 Ga0068852_100278442
109 Ga0075366_10000117
110 Ga0075370_10080382
111 Ga0075429_100078234
112 Ga0105240_10433373
113 Ga0105239_10005380
114 Ga0157373_10109216
115 Ga0157373_10613571
116 Ga0157371_10148478
117 Ga0157370_10003006
118 Ga0157370_10019128
119 Ga0157370_10254434
120 Ga0157369_10080945
121 Ga0157369_10429345
122 Ga0157369_10787474
123 Ga0163162_10000155
124 Ga0157372_10000009
125 Ga0157372_10076987
126 Ga0157372_10394755
127 Ga0157372_10922904
128 Ga0157372_10957899
129 Ga0182008_10009057
130 Ga0182008_10061675
131 Ga0182006_1001115
132 Ga0182007_10007004
133 Ga0206351_10653920
134 Ga0209758_1039059
135 Ga0207695_10132078
136 Ga0207661_10001498
137 Ga0207667_10328407
138 Ga0207678_10003776
139 Ga0207678_11081812
140 Ga0207698_10615156
141 Ga0307515_10000616
142 Ga0316181_1060546
143 Ga0307408_100001267
144 Ga0307405_10019444
145 Ga0307413_10385654
146 Ga0307412_10647891
147 Ga0307416_100348665
148 Ga0307414_10294841
149 Ga0307414_11568114
150 Ga0307411_10181814
151 Ga0307415_100308420
152 Ga0395899_0000220
153 Ga0395900_1171108
154 Ga0395901_0405052
155 Ga0436365_0674884
156 Ga0439436_0021077
157 Ga0451793_1254190
158 Ga0439449_0038840
159 Ga0466969_0030388
160 Ga0466966_0021956
161 Ga0466963_0658777
162 Ga0495605_0331227
163 Ga0495606_0126161
164 Ga0495625_0001400
165 Ga0495661_0001645
166 Ga0495686_0000274
167 Ga0495686_0333589
168 Ga0496115_0066884
169 Ga0501198_001324
170 Ga0501201_000860
171 Ga0501202_000257
172 Ga0501202_081145
173 Ga0501206_000380
174 Ga0501207_002249
175 Ga0501217_015546
176 Ga0501217_040254
177 Ga0501222_000711
178 Ga0501223_000735
179 Ga0501223_018177
180 Ga0501224_001069
181 Ga0501235_002706
182 Ga0501240_005415
183 Ga0501221_003438
184 Ga0501225_0001890
185 Ga0501225_0068258
186 Ga0501234_010346
187 Ga0501245_000258
188 Ga0501241_000811
189 Ga0501241_013645
190 Ga0501264_002459
191 Ga0501280_002948
192 nmdc:mga0k408_49_c2
193 nmdc:mga09592_115047_c1
194 nmdc:mga0qj67_119630_c1
195 nmdc:mga06r32_444421_c1
196 Ga0500622_0000003
197 Ga0466962_0099846
198 2739648356
199 2857629441
200 2885431046
201 2929242407
202 2945999838
203 2977246814
204 2993483671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map