F018945

General Info

Members Datasets Scaffolds Average Seq Length
103 87 103 163

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100001306|Ga0068868_1000013064
Length 179
Sequence MKTLRTIGVYGFDRDSFISALEAAGVDLLLDVRQRRGVRGSEYAWANAQRLQAALAEAGIGYSHLKELAPTTEMRQLQYAEDARLGEGKRNRTALAPAYVERYTAEVLDRADLDPVARWIGSSSAALLCVERDPEACHRSLIAERLGRDHGFKVEHLRPRQKPGGDEDDGALEAPGARG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
47 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
48 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
54 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
55 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
56 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
57 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
58 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
59 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
60 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
61 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
62 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
63 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
64 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
65 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
66 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
67 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
68 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
69 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
70 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
85 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
86 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
87 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 15.53
Rhizosphere 77.67
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100002137 3300005329 Bacteria 15618
2 Ga0070683_100079357 3300005329 Bacteria 3072
3 Ga0070682_100000023 3300005337 Bacteria 206016
4 Ga0068868_100001306 3300005338 Bacteria 17171
5 Ga0070691_10000112 3300005341 Bacteria 24438
6 Ga0070673_100466799 3300005364 Unclassified 1137
7 Ga0070663_101226768 3300005455 Bacteria 660
8 Ga0070678_100030202 3300005456 Bacteria 3723
9 Ga0070679_100545886 3300005530 Bacteria 1103
10 Ga0070684_100047072 3300005535 Bacteria 3737
11 Ga0070684_100081407 3300005535 Bacteria 2865
12 Ga0070686_100514488 3300005544 Bacteria 931
13 Ga0070695_100937126 3300005545 Bacteria 701
14 Ga0070665_100022245 3300005548 Bacteria 6378
15 Ga0068856_100005330 3300005614 Bacteria 12690
16 Ga0068852_100021061 3300005616 Bacteria 5196
17 Ga0068861_100179062 3300005719 Bacteria 1763
18 Ga0068851_10018514 3300005834 Bacteria 3355
19 Ga0068863_100000291 3300005841 Bacteria 51978
20 Ga0068858_100000066 3300005842 Bacteria 108011
21 Ga0068858_100000204 3300005842 Bacteria 63915
22 Ga0070712_100000545 3300006175 Bacteria 21755
23 Ga0097621_100604156 3300006237 Bacteria 1003
24 Ga0105245_10000587 3300009098 Bacteria 32974
25 Ga0105242_10531893 3300009176 Bacteria 1124
26 Ga0105248_10626258 3300009177 Bacteria 1214
27 Ga0157374_10000692 3300013296 Bacteria 29700
28 Ga0157378_10054169 3300013297 Bacteria 3572
29 Ga0157375_10122715 3300013308 Bacteria 2710
30 Ga0157379_11245504 3300014968 Bacteria 717
31 Ga0207656_10010083 3300025321 Bacteria 3526
32 Ga0207693_10044492 3300025915 Bacteria 3489
33 Ga0207687_10000075 3300025927 Bacteria 71856
34 Ga0207686_10216909 3300025934 Bacteria 1379
35 Ga0207704_10392348 3300025938 Bacteria 1093
36 Ga0207711_10504489 3300025941 Bacteria 1128
37 Ga0207661_10006299 3300025944 Bacteria 8395
38 Ga0207651_10340982 3300025960 Unclassified 1259
39 Ga0207668_10944056 3300025972 Bacteria 769
40 Ga0207677_10038087 3300026023 Unclassified 3149
41 Ga0207703_10000042 3300026035 Bacteria 161459
42 Ga0207703_10000054 3300026035 Bacteria 143734
43 Ga0207639_10000644 3300026041 Bacteria 24030
44 Ga0207639_10064441 3300026041 Bacteria 2841
45 Ga0207702_10005218 3300026078 Bacteria 11407
46 Ga0207641_10000252 3300026088 Bacteria 68086
47 Ga0207675_100045512 3300026118 Bacteria 4099
48 Ga0207683_10014172 3300026121 Bacteria 6792
49 Ga0207698_10015535 3300026142 Bacteria 5101
50 Ga0268266_10000099 3300028379 Bacteria 182294
51 Ga0268266_10015981 3300028379 Bacteria 6419
52 Ga0307511_10053899 3300030521 Bacteria 3180
53 Ga0451807_1487548 3300041486 Bacteria 1132
54 Ga0451849_1488578 3300041505 Bacteria 590
55 Ga0451853_3312988 3300041512 Bacteria 848
56 Ga0451853_3957662 3300041512 Bacteria 9070
57 Ga0466963_0075964 3300044694 Bacteria 2268
58 Ga0466967_0334544 3300045976 Bacteria 1463
59 Ga0495629_0000025 3300046459 Bacteria 135624
60 Ga0495629_0096119 3300046459 Bacteria 2066
61 Ga0495641_0105347 3300046461 Bacteria 1258
62 Ga0495641_0125907 3300046461 Bacteria 1143
63 Ga0495639_0065155 3300046475 Bacteria 1675
64 Ga0495662_0002121 3300046476 Bacteria 9950
65 Ga0495606_0000017 3300046507 Bacteria 284549
66 Ga0495618_0382835 3300046514 Bacteria 863
67 Ga0495620_0187098 3300046515 Bacteria 799
68 Ga0495630_0318798 3300046517 Bacteria 1188
69 Ga0495652_0116652 3300046529 Bacteria 2137
70 Ga0495622_0000104 3300046557 Bacteria 73828
71 Ga0495625_0853945 3300046660 Unclassified 525
72 Ga0495588_0000073 3300046674 Bacteria 219005
73 Ga0495623_0092160 3300046679 Bacteria 1858
74 Ga0495647_0000004 3300046681 Bacteria 140700
75 Ga0495647_0197532 3300046681 Bacteria 881
76 Ga0495624_0000007 3300046690 Bacteria 146202
77 Ga0495649_0005608 3300046694 Bacteria 7939
78 Ga0495600_0054199 3300046809 Bacteria 2619
79 Ga0495676_0000480 3300047321 Bacteria 32772
80 Ga0495676_0001370 3300047321 Bacteria 20976
81 Ga0495676_0588017 3300047321 Bacteria 726
82 Ga0495680_0000617 3300047322 Bacteria 40072
83 Ga0496100_0000035 3300048903 Bacteria 97592
84 Ga0496101_0000087 3300048904 Bacteria 101601
85 Ga0496102_0000075 3300048905 Bacteria 147013
86 Ga0496103_0000107 3300048906 Bacteria 91213
87 Ga0496105_1281876 3300048908 Bacteria 536
88 Ga0496106_0000042 3300048909 Bacteria 106662
89 Ga0496106_0000068 3300048909 Bacteria 83053
90 Ga0496107_0000018 3300048910 Bacteria 158433
91 Ga0496107_0127886 3300048910 Bacteria 1874
92 Ga0496110_0006754 3300048913 Bacteria 9127
93 Ga0496110_0085176 3300048913 Bacteria 2821
94 Ga0496111_0464549 3300048914 Bacteria 933
95 Ga0496112_0322412 3300048915 Bacteria 1489
96 Ga0496113_0520782 3300048916 Unclassified 954
97 Ga0496114_0003225 3300048917 Bacteria 12508
98 Ga0496124_0385902 3300048927 Bacteria 978
99 Ga0495601_0000022 3300053077 Bacteria 148418
100 Ga0495601_0157797 3300053077 Bacteria 1482
101 Ga0495655_0001010 3300053083 Bacteria 4345
102 Ga0500566_0003373 3300053094 Bacteria 9535
103 Ga0500614_000472 3300053123 Bacteria 10425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0187098 Ga0495620_0187098_138_614 158
2 3300046529 Ga0495652_0116652 Ga0495652_0116652_1237_1713 158
3 3300053077 Ga0495601_0157797 Ga0495601_0157797_979_1455 158
4 3300005455 Ga0070663_101226768 Ga0070663_1012267682 159
5 3300041505 Ga0451849_1488578 Ga0451849_1488578_80_559 159
6 3300046461 Ga0495641_0105347 Ga0495641_0105347_646_1125 159
7 3300046476 Ga0495662_0002121 Ga0495662_0002121_8832_9320 159
8 3300046679 Ga0495623_0092160 Ga0495623_0092160_712_1191 159
9 3300048908 Ga0496105_1281876 Ga0496105_1281876_36_524 159
10 3300053083 Ga0495655_0001010 Ga0495655_0001010_2476_3012 159
11 3300005329 Ga0070683_100079357 Ga0070683_1000793574 160
12 3300005364 Ga0070673_100466799 Ga0070673_1004667992 160
13 3300005456 Ga0070678_100030202 Ga0070678_1000302023 160
14 3300005535 Ga0070684_100047072 Ga0070684_1000470723 160
15 3300005544 Ga0070686_100514488 Ga0070686_1005144881 160
16 3300005548 Ga0070665_100022245 Ga0070665_1000222453 160
17 3300005616 Ga0068852_100021061 Ga0068852_1000210616 160
18 3300005834 Ga0068851_10018514 Ga0068851_100185145 160
19 3300006175 Ga0070712_100000545 Ga0070712_10000054518 160
20 3300009177 Ga0105248_10626258 Ga0105248_106262583 160
21 3300013296 Ga0157374_10000692 Ga0157374_1000069234 160
22 3300013297 Ga0157378_10054169 Ga0157378_100541693 160
23 3300013308 Ga0157375_10122715 Ga0157375_101227154 160
24 3300025321 Ga0207656_10010083 Ga0207656_100100834 160
25 3300025915 Ga0207693_10044492 Ga0207693_100444923 160
26 3300025938 Ga0207704_10392348 Ga0207704_103923481 160
27 3300025941 Ga0207711_10504489 Ga0207711_105044892 160
28 3300025960 Ga0207651_10340982 Ga0207651_103409821 160
29 3300025972 Ga0207668_10944056 Ga0207668_109440562 160
30 3300026121 Ga0207683_10014172 Ga0207683_100141725 160
31 3300026142 Ga0207698_10015535 Ga0207698_100155356 160
32 3300028379 Ga0268266_10015981 Ga0268266_100159816 160
33 3300044694 Ga0466963_0075964 Ga0466963_0075964_1199_1681 160
34 3300045976 Ga0466967_0334544 Ga0466967_0334544_43_525 160
35 3300046459 Ga0495629_0000025 Ga0495629_0000025_69793_70275 160
36 3300046507 Ga0495606_0000017 Ga0495606_0000017_188530_189012 160
37 3300046514 Ga0495618_0382835 Ga0495618_0382835_275_757 160
38 3300046660 Ga0495625_0853945 Ga0495625_0853945_22_504 160
39 3300046674 Ga0495588_0000073 Ga0495588_0000073_62911_63393 160
40 3300047321 Ga0495676_0588017 Ga0495676_0588017_86_568 160
41 3300048913 Ga0496110_0006754 Ga0496110_0006754_6462_6944 160
42 3300048914 Ga0496111_0464549 Ga0496111_0464549_275_757 160
43 3300048927 Ga0496124_0385902 Ga0496124_0385902_129_611 160
44 3300005530 Ga0070679_100545886 Ga0070679_1005458862 161
45 3300005841 Ga0068863_100000291 Ga0068863_1000002914 161
46 3300014968 Ga0157379_11245504 Ga0157379_112455041 161
47 3300026088 Ga0207641_10000252 Ga0207641_1000025255 161
48 3300041486 Ga0451807_1487548 Ga0451807_1487548_258_743 161
49 3300046459 Ga0495629_0096119 Ga0495629_0096119_1024_1509 161
50 3300046461 Ga0495641_0125907 Ga0495641_0125907_545_1030 161
51 3300046475 Ga0495639_0065155 Ga0495639_0065155_323_808 161
52 3300046681 Ga0495647_0000004 Ga0495647_0000004_75682_76167 161
53 3300048905 Ga0496102_0000075 Ga0496102_0000075_78641_79129 161
54 3300048906 Ga0496103_0000107 Ga0496103_0000107_35423_35911 161
55 3300048915 Ga0496112_0322412 Ga0496112_0322412_739_1251 161
56 3300048916 Ga0496113_0520782 Ga0496113_0520782_31_543 161
57 3300053094 Ga0500566_0003373 Ga0500566_0003373_1165_1650 161
58 3300005719 Ga0068861_100179062 Ga0068861_1001790622 162
59 3300006237 Ga0097621_100604156 Ga0097621_1006041562 162
60 3300026118 Ga0207675_100045512 Ga0207675_1000455124 162
61 3300046557 Ga0495622_0000104 Ga0495622_0000104_69939_70433 162
62 3300005329 Ga0070683_100002137 Ga0070683_1000021379 163
63 3300005337 Ga0070682_100000023 Ga0070682_10000002377 163
64 3300005338 Ga0068868_100001306 Ga0068868_1000013064 163
65 3300005341 Ga0070691_10000112 Ga0070691_100001127 163
66 3300005535 Ga0070684_100081407 Ga0070684_1000814072 163
67 3300005545 Ga0070695_100937126 Ga0070695_1009371261 163
68 3300005614 Ga0068856_100005330 Ga0068856_1000053306 163
69 3300005842 Ga0068858_100000066 Ga0068858_10000006672 163
70 3300005842 Ga0068858_100000204 Ga0068858_10000020429 163
71 3300009098 Ga0105245_10000587 Ga0105245_1000058711 163
72 3300009176 Ga0105242_10531893 Ga0105242_105318932 163
73 3300025927 Ga0207687_10000075 Ga0207687_1000007552 163
74 3300025934 Ga0207686_10216909 Ga0207686_102169092 163
75 3300025944 Ga0207661_10006299 Ga0207661_100062992 163
76 3300026023 Ga0207677_10038087 Ga0207677_100380872 163
77 3300026035 Ga0207703_10000042 Ga0207703_10000042152 163
78 3300026035 Ga0207703_10000054 Ga0207703_1000005471 163
79 3300026041 Ga0207639_10000644 Ga0207639_100006445 163
80 3300026041 Ga0207639_10064441 Ga0207639_100644412 163
81 3300026078 Ga0207702_10005218 Ga0207702_100052185 163
82 3300028379 Ga0268266_10000099 Ga0268266_1000009972 163
83 3300030521 Ga0307511_10053899 Ga0307511_100538993 163
84 3300041512 Ga0451853_3312988 Ga0451853_3312988_127_618 163
85 3300041512 Ga0451853_3957662 Ga0451853_3957662_1144_1635 163
86 3300046517 Ga0495630_0318798 Ga0495630_0318798_435_929 163
87 3300046681 Ga0495647_0197532 Ga0495647_0197532_169_663 163
88 3300046690 Ga0495624_0000007 Ga0495624_0000007_87122_87616 163
89 3300046694 Ga0495649_0005608 Ga0495649_0005608_5882_6376 163
90 3300046809 Ga0495600_0054199 Ga0495600_0054199_848_1342 163
91 3300047321 Ga0495676_0000480 Ga0495676_0000480_27749_28255 163
92 3300047321 Ga0495676_0001370 Ga0495676_0001370_10032_10526 163
93 3300047322 Ga0495680_0000617 Ga0495680_0000617_34960_35454 163
94 3300048903 Ga0496100_0000035 Ga0496100_0000035_30035_30541 163
95 3300048904 Ga0496101_0000087 Ga0496101_0000087_34079_34585 163
96 3300048909 Ga0496106_0000042 Ga0496106_0000042_2106_2615 163
97 3300048909 Ga0496106_0000068 Ga0496106_0000068_48907_49413 163
98 3300048910 Ga0496107_0000018 Ga0496107_0000018_142516_143022 163
99 3300048910 Ga0496107_0127886 Ga0496107_0127886_802_1311 163
100 3300048913 Ga0496110_0085176 Ga0496110_0085176_406_900 163
101 3300048917 Ga0496114_0003225 Ga0496114_0003225_2129_2623 163
102 3300053077 Ga0495601_0000022 Ga0495601_0000022_56720_57214 163
103 3300053123 Ga0500614_000472 Ga0500614_000472_6021_6515 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

13

146

0.87

PF22751

DUF488-N3a

Active DUF488-N3 subclade

22

150

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x2q-assembly2.cif.gz_D crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with glycine 0.7052 15 64
3nd1-assembly1.cif.gz_A crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.6229 1 159
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.6214 2 159
6pqz-assembly1.cif.gz_B p133g/s128a s. typhimurium siroheme synthase 0.6135 2 159
3qi7-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (yp_001089212.1) from clostridium difficile 630 at 1.86 a resolution 0.6083 2 156
ID Description Score Start End Superfamily
3nd1A01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6161 1 159 3.40.1010.10
3nd1A01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6048 1 159 3.40.1010.10
3gxhB00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6018 1 148 3.90.190.10
4n7bA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain 0.5923 2 162 3.40.1010.20
af_Q9VTT6_1_302_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5816 15 65 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A538LBS7-F1-model_v4 DUF488 domain-containing protein 0.987 1 159
AF-A0A839RJP6-F1-model_v4 Uncharacterized protein (DUF488 family) 0.9862 1 159
AF-A0A538JD08-F1-model_v4 DUF488 domain-containing protein 0.986 2 159
AF-A0A7W7FVV0-F1-model_v4 Uncharacterized protein (DUF488 family) 0.9816 6 146
AF-A0A838V5Y6-F1-model_v4 DUF488 domain-containing protein 0.9786 61 160

Feature Viewer

pLDDT pTM Quality
91.96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map