F024004

General Info

Members Datasets Scaffolds Average Seq Length
104 79 207 195

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10031575|rootL2_100315752
Length 231
Sequence MLSKKSRLLKVTGTFYGDDTPVSPFASNFDIFVKNGVSMFEVFAAYLKEKAGLTDEELDQVRAVTINKRLRKRQYLLQEGDICHYNCFVAKGCLRNYRVSEDGVEHILRFAVENWWLSDTESYNNGTPTRNNIDALEDSDLLLIEKKDFDQLLNTITRFREFIDRLKARSFDVSQNRIMSNISDTAEERYLNFMKSYPDIFNRVPLHMIASYLGVSRETLSRIRNQYSKTH

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
27 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
28 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
35 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
36 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
37 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
42 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
43 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
44 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
49 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
50 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
51 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
52 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
53 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
54 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
55 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
56 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
57 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
58 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
59 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
60 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
61 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
62 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
63 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
64 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
65 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
66 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
67 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
68 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
69 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
70 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
71 2738541278 Niastella sp. CF465 Isolate Unclassified
72 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
73 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
74 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
75 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
76 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
77 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
78 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
79 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.42
Metatranscriptomes 0
Isolates 10.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.04
Nodule 0
Rhizoplane 2.88
Rhizosphere 43.27
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10031575 3300003322 Bacteria 2723
2 JGI25162J39368_1000005 3300002737 Bacteria 435925
3 JGI25154J39366_1000028 3300002738 Bacteria 195818
4 JGI25154J39366_1000076 3300002738 Bacteria 91215
5 JGI25158J39367_1007357 3300002739 Bacteria 1556
6 JGI25157J39369_1002381 3300002741 Bacteria 4785
7 JGI25157J39369_1003373 3300002741 Unclassified 3296
8 JGI25153J46596_10005490 3300003215 Bacteria 6640
9 JGI25153J46596_10006242 3300003215 Bacteria 6094
10 rootH2_10078637 3300003320 Bacteria 4867
11 rootL2_10340829 3300003322 Bacteria 1186
12 rootH1_10069980 3300003316 Bacteria 7101
13 rootH1_10069980 3300003323 Bacteria 3584
14 rootH1_10087734 3300003323 Bacteria 3813
15 rootH1_10107283 3300003323 Bacteria 4679
16 rootH1_10174540 3300003323 Bacteria 2831
17 JGI25160J50197_1002093 3300003354 Bacteria 9485
18 JGI25160J50197_1010698 3300003354 Bacteria 3299
19 Ga0055531_10000198 3300003794 Bacteria 66737
20 Ga0055531_10000258 3300003794 Bacteria 56433
21 Ga0065165_1022403 3300005262 Bacteria 2167
22 Ga0075366_10202900 3300006195 Bacteria 1206
23 Ga0097621_100945235 3300006237 Bacteria 804
24 Ga0105241_10828169 3300009174 Unclassified 854
25 Ga0105237_10000087 3300009545 Bacteria 124934
26 Ga0105238_10462036 3300009551 Bacteria 1267
27 Ga0105239_10227530 3300010375 Unclassified 2092
28 Ga0157373_10149087 3300013100 Bacteria 1645
29 Ga0157370_10000018 3300013104 Bacteria 169223
30 Ga0157370_10345053 3300013104 Bacteria 1372
31 Ga0157374_10039593 3300013296 Bacteria 4338
32 Ga0163162_10007860 3300013306 Bacteria 10391
33 Ga0157375_10000871 3300013308 Bacteria 26276
34 Ga0157375_10288256 3300013308 Bacteria 1805
35 Ga0182008_10189089 3300014497 Bacteria 1044
36 Ga0182005_1000224 3300015265 Bacteria 37425
37 Ga0163161_10461033 3300017792 Bacteria 1029
38 Ga0209437_100043 3300025233 Bacteria 440454
39 Ga0209646_1000003 3300025246 Bacteria 1160860
40 Ga0209646_1000006 3300025246 Bacteria 694084
41 Ga0209026_1000185 3300025250 Bacteria 91252
42 Ga0209026_1000343 3300025250 Bacteria 44904
43 Ga0209758_1002518 3300025297 Bacteria 18568
44 Ga0209758_1005337 3300025297 Bacteria 9993
45 Ga0207426_1000209 3300025302 Bacteria 139524
46 Ga0207426_1000908 3300025302 Bacteria 29684
47 Ga0209257_1000008 3300025304 Bacteria 1294570
48 Ga0207671_10000096 3300025914 Bacteria 135750
49 Ga0207694_10322372 3300025924 Bacteria 1275
50 Ga0316177_1093313 3300030731 Bacteria 5047
51 Ga0316176_1002742 3300030732 Bacteria 81202
52 Ga0316183_1128744 3300030742 Bacteria 48494
53 Ga0316181_1109246 3300030744 Bacteria 74541
54 Ga0307408_100631101 3300031548 Bacteria 956
55 Ga0307412_10230581 3300031911 Bacteria 1426
56 Ga0307416_100549680 3300032002 Bacteria 1228
57 Ga0451793_1486230 3300041452 Bacteria 683
58 Ga0451807_0734017 3300041486 Unclassified 839
59 Ga0451833_1284166 3300041491 Bacteria 621
60 Ga0451847_0398356 3300041503 Bacteria 869
61 Ga0451853_3277733 3300041512 Bacteria 780
62 Ga0466957_0011957 3300044842 Bacteria 5018
63 Ga0495606_0012701 3300046507 Bacteria 6721
64 Ga0495606_0033345 3300046507 Bacteria 3552
65 Ga0495606_0071636 3300046507 Bacteria 2181
66 Ga0495606_0118653 3300046507 Bacteria 1586
67 Ga0495606_0148993 3300046507 Bacteria 1375
68 Ga0495606_0332825 3300046507 Unclassified 812
69 Ga0495610_0000062 3300046512 Bacteria 128923
70 Ga0495633_0027018 3300046558 Bacteria 2809
71 Ga0495611_0000367 3300046648 Bacteria 29199
72 Ga0495625_0021122 3300046660 Bacteria 5017
73 Ga0495661_0052288 3300046665 Bacteria 2462
74 Ga0495660_0017429 3300046810 Bacteria 4136
75 Ga0495683_0154399 3300047323 Unclassified 1066
76 Ga0495673_0223900 3300047469 Bacteria 695
77 Ga0495686_0000040 3300047472 Bacteria 301210
78 Ga0495686_0000443 3300047472 Bacteria 62754
79 Ga0495686_0026783 3300047472 Bacteria 3771
80 Ga0496101_0168023 3300048904 Bacteria 1685
81 Ga0496121_0000051 3300048924 Bacteria 315378
82 Ga0496125_0035958 3300048928 Bacteria 4333
83 Ga0496126_0008322 3300048929 Bacteria 11201
84 Ga0501241_001140 3300049758 Bacteria 5520
85 Ga0500578_0000178 3300053086 Bacteria 76527
86 Ga0500644_0000653 3300053088 Bacteria 12842
87 Ga0500562_104097 3300053108 Bacteria 773
88 Ga0500618_031265 3300053125 Bacteria 1248
89 Ga0500559_0008945 3300053136 Bacteria 4358
90 Ga0500622_0000012 3300053156 Bacteria 383183
91 Ga0500622_0000051 3300053156 Bacteria 145514
92 Ga0500633_0003225 3300053160 Unclassified 3518
93 Ga0500661_009431 3300055283 Unclassified 1786
94 2644009071 2643221600 Bacteria 5530138
95 2644011084 2643221600 Bacteria 5530138
96 2738727718 2738541278 Bacteria 9755573
97 2842905708 2842903701 Bacteria 6986368
98 2884795876 2884791551 Bacteria 8511252
99 2919441893 2919437846 Bacteria 6199444
100 2929157080 2929154850 Bacteria 6753285
101 2929182104 2929177148 Bacteria 7883697
102 2929242256 2929239360 Bacteria 7745570
103 2929927392 2929921140 Bacteria 8649150
104 8003151661 8003151029 Bacteria 8187759
105 rootL2_10031575
106 JGI25162J39368_1000005
107 JGI25154J39366_1000028
108 JGI25154J39366_1000076
109 JGI25158J39367_1007357
110 JGI25157J39369_1002381
111 JGI25157J39369_1003373
112 JGI25153J46596_10005490
113 JGI25153J46596_10006242
114 rootH2_10078637
115 rootL2_10340829
116 rootH1_10069980
117 rootH1_10087734
118 rootH1_10107283
119 rootH1_10174540
120 JGI25160J50197_1002093
121 JGI25160J50197_1010698
122 Ga0055531_10000198
123 Ga0055531_10000258
124 Ga0065165_1022403
125 Ga0075366_10202900
126 Ga0097621_100945235
127 Ga0105241_10828169
128 Ga0105237_10000087
129 Ga0105238_10462036
130 Ga0105239_10227530
131 Ga0157373_10149087
132 Ga0157370_10000018
133 Ga0157370_10345053
134 Ga0157374_10039593
135 Ga0163162_10007860
136 Ga0157375_10000871
137 Ga0157375_10288256
138 Ga0182008_10189089
139 Ga0182005_1000224
140 Ga0163161_10461033
141 Ga0209437_100043
142 Ga0209646_1000003
143 Ga0209646_1000006
144 Ga0209026_1000185
145 Ga0209026_1000343
146 Ga0209758_1002518
147 Ga0209758_1005337
148 Ga0207426_1000209
149 Ga0207426_1000908
150 Ga0209257_1000008
151 Ga0207671_10000096
152 Ga0207694_10322372
153 Ga0316177_1093313
154 Ga0316176_1002742
155 Ga0316183_1128744
156 Ga0316181_1109246
157 Ga0307408_100631101
158 Ga0307412_10230581
159 Ga0307416_100549680
160 Ga0451793_1486230
161 Ga0451807_0734017
162 Ga0451833_1284166
163 Ga0451847_0398356
164 Ga0451853_3277733
165 Ga0466957_0011957
166 Ga0495606_0012701
167 Ga0495606_0033345
168 Ga0495606_0071636
169 Ga0495606_0118653
170 Ga0495606_0148993
171 Ga0495606_0332825
172 Ga0495610_0000062
173 Ga0495633_0027018
174 Ga0495611_0000367
175 Ga0495625_0021122
176 Ga0495661_0052288
177 Ga0495660_0017429
178 Ga0495683_0154399
179 Ga0495673_0223900
180 Ga0495686_0000040
181 Ga0495686_0000443
182 Ga0495686_0026783
183 Ga0496101_0168023
184 Ga0496121_0000051
185 Ga0496125_0035958
186 Ga0496126_0008322
187 Ga0501241_001140
188 Ga0500578_0000178
189 Ga0500644_0000653
190 Ga0500562_104097
191 Ga0500618_031265
192 Ga0500559_0008945
193 Ga0500622_0000012
194 Ga0500622_0000051
195 Ga0500633_0003225
196 Ga0500661_009431
197 2644009071
198 2644011084
199 2738727718
200 2842905708
201 2884795876
202 2919441893
203 2929157080
204 2929182104
205 2929242256
206 2929927392
207 8003151661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

67

156

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.9615 1 137
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.8979 1 137
3i59-assembly1.cif.gz_A crystal structure of mtbcrp in complex with n6-camp 0.8893 29 192
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.8848 20 192
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.8792 28 198
ID Description Score Start End Superfamily
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9659 3 137 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.927 28 146 2.60.120.10
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9006 3 137 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8844 28 146 2.60.120.10
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8765 20 145 2.60.120.10
ID Description Score Start End GO Terms
AF-J0L9T8-F1-model_v4 cAMP-binding protein 0.976 50 192
AF-A0A2T5Y290-F1-model_v4 deleted 0.9719 2 185
AF-A0A6N3EK81-F1-model_v4 Transcriptional activator FtrB 0.9683 15 192
AF-R7J576-F1-model_v4 Cyclic nucleotide-binding domain protein 0.9678 27 188
AF-A0A5R9PMK0-F1-model_v4 deleted 0.9677 3 189

Map