F028495

General Info

Members Datasets Scaffolds Average Seq Length
104 86 208 138

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0141611|Ga0495626_0141611_15_473
Length 152
Sequence MIITFQKEFKKMYTKPLVYFLCTGNSCRSQIADGFLNAIGGDKFEVKSAGLEAHGLNPRAIQVMEEAGIDISGNSSDVINPEILNRATYVITLCGHADEHCPAIMNPNVIKWHWGFDDPAKATGTEEEIMEQFRTVRDSIKARIEQFVINGE

Samples

Sample ID Description Type Environment
1 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
59 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
60 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
61 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
62 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
63 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
64 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
65 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
66 2671180694 Paenibacillus sp. A3 Isolate Unclassified
67 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
68 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
69 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
70 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
71 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
72 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
73 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
74 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
75 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
76 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
77 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
78 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
79 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
80 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
81 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
82 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
83 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
84 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
85 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
86 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.92
Metatranscriptomes 0
Isolates 23.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.42
Nodule 0.96
Rhizoplane 0.96
Rhizosphere 58.65
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495626_0141611 3300048091 Bacteria 1020
2 JGI25159J45721_1032712 3300002987 Bacteria 820
3 rootH2_10302202 3300003320 Bacteria 2079
4 rootH1_10030020 3300003323 Bacteria 1883
5 rootH1_10245346 3300003323 Bacteria 1558
6 rootH1_10385986 3300003323 Bacteria 2299
7 JGI25160J50197_1042054 3300003354 Bacteria 1043
8 Ga0055541_1001108 3300003841 Bacteria 6095
9 Ga0065712_10789498 3300005290 Unclassified 516
10 Ga0070677_10338246 3300005333 Bacteria 776
11 Ga0068868_102308670 3300005338 Unclassified 513
12 Ga0070675_100963816 3300005354 Unclassified 783
13 Ga0070678_101692156 3300005456 Bacteria 595
14 Ga0068855_100038887 3300005563 Bacteria 5650
15 Ga0068857_100021639 3300005577 Bacteria 5658
16 Ga0068856_100014383 3300005614 Bacteria 7648
17 Ga0068856_102008472 3300005614 Bacteria 588
18 Ga0068859_102224199 3300005617 Unclassified 605
19 Ga0068866_10010040 3300005718 Bacteria 4047
20 Ga0068861_100433493 3300005719 Bacteria 1174
21 Ga0075367_11028238 3300006178 Bacteria 526
22 Ga0075366_10528424 3300006195 Bacteria 730
23 Ga0075366_11060293 3300006195 Bacteria 506
24 Ga0097621_100823231 3300006237 Bacteria 861
25 Ga0097621_101613708 3300006237 Bacteria 617
26 Ga0097620_102225387 3300006931 Unclassified 605
27 Ga0105240_10566950 3300009093 Bacteria 1254
28 Ga0105241_10130054 3300009174 Bacteria 2037
29 Ga0105237_10055032 3300009545 Bacteria 3985
30 Ga0105237_10193851 3300009545 Bacteria 2031
31 Ga0105239_10025119 3300010375 Bacteria 6562
32 Ga0105239_10714181 3300010375 Bacteria 1146
33 Ga0157370_11228931 3300013104 Bacteria 676
34 Ga0157374_10060241 3300013296 Bacteria 3552
35 Ga0157372_10008804 3300013307 Bacteria 10717
36 Ga0157375_10358008 3300013308 Bacteria 1625
37 Ga0182008_10453624 3300014497 Bacteria 698
38 Ga0182007_10016802 3300015262 Bacteria 2690
39 Ga0163161_10000007 3300017792 Bacteria 301614
40 Ga0163161_10000710 3300017792 Bacteria 26388
41 Ga0163161_10017141 3300017792 Bacteria 5066
42 Ga0163161_10437508 3300017792 Bacteria 1055
43 Ga0209436_100843 3300025208 Bacteria 12365
44 Ga0209566_100137 3300025225 Bacteria 89967
45 Ga0209130_1001462 3300025284 Bacteria 15516
46 Ga0209675_1000755 3300025291 Bacteria 21747
47 Ga0209025_1006662 3300025294 Bacteria 8873
48 Ga0207426_1000288 3300025302 Bacteria 100477
49 Ga0207642_10029706 3300025899 Bacteria 2267
50 Ga0207654_10071040 3300025911 Bacteria 2068
51 Ga0207695_10478017 3300025913 Bacteria 1128
52 Ga0207671_10006318 3300025914 Bacteria 10576
53 Ga0207671_10030733 3300025914 Bacteria 4003
54 Ga0207686_10591854 3300025934 Unclassified 872
55 Ga0207667_10009022 3300025949 Bacteria 11794
56 Ga0207702_10021411 3300026078 Bacteria 5353
57 Ga0207702_10081741 3300026078 Bacteria 2806
58 Ga0207648_10844517 3300026089 Bacteria 854
59 Ga0207675_100159695 3300026118 Bacteria 2149
60 Ga0207683_10427487 3300026121 Bacteria 1220
61 Ga0265327_10003081 3300031251 Bacteria 16450
62 Ga0451577_0933972 3300042876 Bacteria 780
63 Ga0466969_0000030 3300044656 Bacteria 90368
64 Ga0466966_0000293 3300044684 Bacteria 32754
65 Ga0466961_0288106 3300044693 Bacteria 1004
66 Ga0466964_0148136 3300044706 Bacteria 1085
67 Ga0466970_0152929 3300044765 Bacteria 1274
68 Ga0466959_0000021 3300045049 Bacteria 132387
69 Ga0466959_0543429 3300045049 Bacteria 784
70 Ga0451576_0765158 3300045051 Unclassified 1014
71 Ga0496110_0090369 3300048913 Bacteria 2738
72 Ga0496116_0038819 3300048919 Bacteria 3301
73 Ga0496116_0051341 3300048919 Bacteria 2740
74 Ga0496116_0077794 3300048919 Unclassified 2071
75 Ga0496122_0117270 3300048925 Bacteria 1728
76 Ga0496122_0121507 3300048925 Bacteria 1683
77 Ga0496124_0280800 3300048927 Bacteria 1214
78 nmdc:mga0k408_108942_c1 3300050493 Bacteria 1636
79 nmdc:mga0k408_914469_c1 3300050493 Bacteria 509
80 nmdc:mga06z11_945172_c1 3300050494 Bacteria 525
81 2524186679 2524023129 Bacteria 6762600
82 2644011370 2643221600 Bacteria 5530138
83 2673817131 2671180694 Bacteria 7506943
84 2673822402 2671180694 Bacteria 7506943
85 2738732040 2738541279 Bacteria 6149495
86 2738764605 2738541285 Bacteria 6150075
87 2739213620 2738543007 Bacteria 6149845
88 2740001897 2739367857 Bacteria 5433684
89 2740006713 2739367858 Bacteria 5432813
90 2857471444 2857465823 Bacteria 6772595
91 2865004618 2865002811 Bacteria 6333767
92 2884793458 2884791551 Bacteria 8511252
93 2888581896 2888578766 Bacteria 6743310
94 2896089759 2896085136 Bacteria 6129793
95 2898911255 2898907183 Bacteria 4067722
96 2919193963 2919191525 Bacteria 5765973
97 2925330809 2925326138 Bacteria 9652120
98 2929299142 2929297113 Bacteria 3141306
99 2971412180 2971410472 Bacteria 8311090
100 2980128510 2980125574 Bacteria 5567337
101 8046998207 8046991243 Bacteria 8497463
102 8054800092 8054795415 Bacteria 9785225
103 8057739140 8057733483 Bacteria 6578323
104 8057981842 8057977335 Bacteria 5694872
105 Ga0495626_0141611
106 JGI25159J45721_1032712
107 rootH2_10302202
108 rootH1_10030020
109 rootH1_10245346
110 rootH1_10385986
111 JGI25160J50197_1042054
112 Ga0055541_1001108
113 Ga0065712_10789498
114 Ga0070677_10338246
115 Ga0068868_102308670
116 Ga0070675_100963816
117 Ga0070678_101692156
118 Ga0068855_100038887
119 Ga0068857_100021639
120 Ga0068856_100014383
121 Ga0068856_102008472
122 Ga0068859_102224199
123 Ga0068866_10010040
124 Ga0068861_100433493
125 Ga0075367_11028238
126 Ga0075366_10528424
127 Ga0075366_11060293
128 Ga0097621_100823231
129 Ga0097621_101613708
130 Ga0097620_102225387
131 Ga0105240_10566950
132 Ga0105241_10130054
133 Ga0105237_10055032
134 Ga0105237_10193851
135 Ga0105239_10025119
136 Ga0105239_10714181
137 Ga0157370_11228931
138 Ga0157374_10060241
139 Ga0157372_10008804
140 Ga0157375_10358008
141 Ga0182008_10453624
142 Ga0182007_10016802
143 Ga0163161_10000007
144 Ga0163161_10000710
145 Ga0163161_10017141
146 Ga0163161_10437508
147 Ga0209436_100843
148 Ga0209566_100137
149 Ga0209130_1001462
150 Ga0209675_1000755
151 Ga0209025_1006662
152 Ga0207426_1000288
153 Ga0207642_10029706
154 Ga0207654_10071040
155 Ga0207695_10478017
156 Ga0207671_10006318
157 Ga0207671_10030733
158 Ga0207686_10591854
159 Ga0207667_10009022
160 Ga0207702_10021411
161 Ga0207702_10081741
162 Ga0207648_10844517
163 Ga0207675_100159695
164 Ga0207683_10427487
165 Ga0265327_10003081
166 Ga0451577_0933972
167 Ga0466969_0000030
168 Ga0466966_0000293
169 Ga0466961_0288106
170 Ga0466964_0148136
171 Ga0466970_0152929
172 Ga0466959_0000021
173 Ga0466959_0543429
174 Ga0451576_0765158
175 Ga0496110_0090369
176 Ga0496116_0038819
177 Ga0496116_0051341
178 Ga0496116_0077794
179 Ga0496122_0117270
180 Ga0496122_0121507
181 Ga0496124_0280800
182 nmdc:mga0k408_108942_c1
183 nmdc:mga0k408_914469_c1
184 nmdc:mga06z11_945172_c1
185 2524186679
186 2644011370
187 2673817131
188 2673822402
189 2738732040
190 2738764605
191 2739213620
192 2740001897
193 2740006713
194 2857471444
195 2865004618
196 2884793458
197 2888581896
198 2896089759
199 2898911255
200 2919193963
201 2925330809
202 2929299142
203 2971412180
204 2980128510
205 8046998207
206 8054800092
207 8057739140
208 8057981842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

18

148

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9526 1 134
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9526 1 137
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9455 1 137
1jl3-assembly4.cif.gz_D crystal structure of b. subtilis arsc 0.9435 2 137
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9415 1 133
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9387 2 137 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9312 2 137 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8994 1 137 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8913 1 135 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8808 1 135 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1N6DYB7-F1-model_v4 Protein tyrosine phosphatase 0.9914 1 137 GO:0046685
AF-A0A7C5GVU1-F1-model_v4 Arsenate reductase ArsC 0.9798 2 135 GO:0046685
AF-A0A093XZ27-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9796 2 135 GO:0046685
AF-A0A5R8KCJ9-F1-model_v4 Arsenate reductase ArsC 0.9768 4 135 GO:0046685
AF-A0A069S6E5-F1-model_v4 deleted 0.9749 2 135

Map