F028869

General Info

Members Datasets Scaffolds Average Seq Length
104 80 208 423

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0000038|Ga0501069_0000038_48790_50187
Length 465
Sequence VPEPTLVIKGGRLIDATGERNADVVVGDDGTVLAVGTGLDAPRTLDAGGCVVSPGLVDLHAHLRQPGKEEAETIETGSRCAALGGFTAVVAMPNTTPAIDSAAVVREVQDLARTAMCEVAVAGAITLGRRGDTLAPMAEMAALGVRLFTDDGSGVEDNRLMRRALEYASGLPQPVVLAQHCEDGALNAGGHMHEGEWSARLGIPGQPAEAEELMVMRDIALARLTGQRVHFQHLSTAGSVVMVRAAKAAGLPVSAEATAHHLALTDALCASYDPVFKVNPPLRTTTDVLAVRDGLADGAIDAIATDHAPHEQEAKEQPFDQAPPGMLGLETVLAVALTTMAGDADPPDGFAAEGVVPVDPTGELGAGNGRNGIATRGRASLGDVLGALSWRPASIAGLDHHGGPIVAGRAAHLAVIDPTATWTVDAAASASRSRNNPWAGLELRGKVRHTLWRGEPIVIDGEAQR

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
4 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
5 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
10 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
11 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
14 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
15 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
22 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
23 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
24 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
25 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
26 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
27 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
28 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
29 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
30 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
31 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
32 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
33 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
34 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
35 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
36 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
37 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
38 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
46 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
47 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
48 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
49 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
50 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
51 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
52 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
53 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
54 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
55 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
56 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
57 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
58 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
66 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
67 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
68 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
69 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
70 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
71 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
74 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
75 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
78 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
79 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
80 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 0
Rhizoplane 5.77
Rhizosphere 79.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0000038 3300049585 Bacteria 82519
2 Ga0070714_100005705 3300005435 Bacteria 9536
3 Ga0070686_100165721 3300005544 Bacteria 1559
4 Ga0068860_100027954 3300005843 Bacteria 5431
5 Ga0075365_10007626 3300006038 Bacteria 6080
6 Ga0075365_10054933 3300006038 Bacteria 2642
7 Ga0075363_100013994 3300006048 Bacteria 3907
8 Ga0075364_10036284 3300006051 Bacteria 3187
9 Ga0075367_10051443 3300006178 Bacteria 2435
10 Ga0075428_100000040 3300006844 Bacteria 102788
11 Ga0075436_100044697 3300006914 Bacteria 3055
12 Ga0111539_10003370 3300009094 Bacteria 21077
13 Ga0111539_10054131 3300009094 Bacteria 4775
14 Ga0111539_10144543 3300009094 Bacteria 2784
15 Ga0105245_10018188 3300009098 Bacteria 6144
16 Ga0213873_10003275 3300021358 Bacteria 2901
17 Ga0213876_10034002 3300021384 Bacteria 2687
18 Ga0207687_10137977 3300025927 Bacteria 1847
19 Ga0207664_10090704 3300025929 Bacteria 2505
20 Ga0207644_10001901 3300025931 Bacteria 13554
21 Ga0207703_10036629 3300026035 Bacteria 3906
22 Ga0268266_10115735 3300028379 Bacteria 2381
23 Ga0268264_10019044 3300028381 Bacteria 5612
24 Ga0265327_10000231 3300031251 Bacteria 113114
25 Ga0265327_10005704 3300031251 Bacteria 10274
26 Ga0316576_10085572 3300031727 Bacteria 2343
27 Ga0307413_10054815 3300031824 Bacteria 2422
28 Ga0307409_100066097 3300031995 Bacteria 2849
29 Ga0373948_0001862 3300034817 Bacteria 3013
30 Ga0373929_0004356 3300035085 Bacteria 2540
31 Ga0316574_0019127 3300035398 Bacteria 4037
32 Ga0316574_0136847 3300035398 Bacteria 1577
33 Ga0373931_0000001 3300035691 Bacteria 634029
34 Ga0373931_0000019 3300035691 Bacteria 186534
35 Ga0373937_0006968 3300036401 Bacteria 9756
36 Ga0373937_0176151 3300036401 Bacteria 2008
37 Ga0395905_0251215 3300037471 Bacteria 1652
38 Ga0400483_062577 3300039062 Bacteria 66463
39 Ga0400483_201997 3300039062 Bacteria 26527
40 Ga0436365_0279892 3300039437 Bacteria 3731
41 Ga0436360_0328594 3300039438 Bacteria 4474
42 Ga0436361_0661258 3300039447 Bacteria 2789
43 Ga0436362_0295859 3300039453 Bacteria 3646
44 Ga0436362_0654584 3300039453 Bacteria 1395
45 Ga0451807_0434801 3300041486 Bacteria 4308
46 Ga0451843_0041294 3300041509 Bacteria 1787
47 Ga0439434_0014428 3300042435 Bacteria 2350
48 Ga0451577_0030454 3300042876 Bacteria 4876
49 Ga0466966_0051172 3300044684 Bacteria 2626
50 Ga0466966_0201272 3300044684 Bacteria 1205
51 Ga0466961_0066673 3300044693 Bacteria 2286
52 Ga0453684_0051109 3300044712 Bacteria 5425
53 Ga0466957_0107287 3300044842 Bacteria 1768
54 Ga0466959_0086816 3300045049 Bacteria 2251
55 Ga0495651_0013184 3300046462 Bacteria 6389
56 Ga0495653_0054150 3300046463 Bacteria 3067
57 Ga0495583_0082383 3300046506 Bacteria 1396
58 Ga0495608_0033923 3300046511 Bacteria 3446
59 Ga0495630_0066178 3300046517 Bacteria 2716
60 Ga0495621_0036904 3300046539 Bacteria 1698
61 Ga0495667_0001375 3300046559 Bacteria 16005
62 Ga0495623_0014853 3300046679 Bacteria 5036
63 Ga0495672_0004275 3300047320 Bacteria 11785
64 Ga0495675_0099422 3300047444 Bacteria 1822
65 Ga0495684_0201093 3300047471 Bacteria 1469
66 Ga0496104_0043862 3300048907 Bacteria 4201
67 Ga0496110_0030567 3300048913 Bacteria 4644
68 Ga0496110_0071133 3300048913 Bacteria 3084
69 Ga0496114_0028203 3300048917 Bacteria 4605
70 Ga0496114_0319391 3300048917 Bacteria 1372
71 Ga0501032_0008937 3300049569 Bacteria 7286
72 Ga0501034_0000034 3300049571 Bacteria 242608
73 Ga0501034_0004646 3300049571 Bacteria 15205
74 Ga0501034_0005858 3300049571 Bacteria 13370
75 Ga0501037_0002953 3300049573 Bacteria 12332
76 Ga0501037_0019964 3300049573 Bacteria 4946
77 Ga0501041_0107234 3300049577 Bacteria 1732
78 Ga0501041_0127434 3300049577 Bacteria 1585
79 Ga0501042_0189158 3300049578 Bacteria 1485
80 Ga0501068_0000047 3300049584 Bacteria 46268
81 Ga0501068_0023089 3300049584 Bacteria 3644
82 Ga0501069_0000874 3300049585 Bacteria 14348
83 Ga0501070_0000008 3300049586 Bacteria 199963
84 Ga0501070_0045591 3300049586 Bacteria 3647
85 Ga0501071_0008464 3300049587 Bacteria 6803
86 Ga0501071_0023990 3300049587 Bacteria 4264
87 Ga0501073_0004975 3300049589 Bacteria 9976
88 Ga0501073_0071753 3300049589 Bacteria 2412
89 Ga0501074_0021901 3300049590 Bacteria 4640
90 Ga0501076_0114885 3300049592 Bacteria 2178
91 Ga0501080_0002411 3300049742 Bacteria 16315
92 Ga0501080_0094562 3300049742 Bacteria 2775
93 Ga0501080_0139932 3300049742 Bacteria 2238
94 Ga0501081_0101122 3300049743 Bacteria 2038
95 Ga0501083_0042012 3300049744 Bacteria 3100
96 nmdc:mga03n38_76043_c1 3300050490 Bacteria 1565
97 nmdc:mga00v17_14049_c1 3300050491 Bacteria 4064
98 nmdc:mga0yw44_74314_c1 3300050492 Bacteria 2117
99 nmdc:mga0yw44_836_c1 3300050492 Bacteria 7397
100 nmdc:mga08y16_317316_c1 3300050511 Bacteria 1605
101 Ga0495595_0053832 3300053084 Bacteria 1870
102 Ga0500568_0000022 3300053139 Bacteria 184816
103 Ga0501084_0022223 3300054114 Bacteria 5293
104 Ga0501082_0062165 3300060353 Bacteria 3214
105 Ga0501069_0000038
106 Ga0070714_100005705
107 Ga0070686_100165721
108 Ga0068860_100027954
109 Ga0075365_10007626
110 Ga0075365_10054933
111 Ga0075363_100013994
112 Ga0075364_10036284
113 Ga0075367_10051443
114 Ga0075428_100000040
115 Ga0075436_100044697
116 Ga0111539_10003370
117 Ga0111539_10054131
118 Ga0111539_10144543
119 Ga0105245_10018188
120 Ga0213873_10003275
121 Ga0213876_10034002
122 Ga0207687_10137977
123 Ga0207664_10090704
124 Ga0207644_10001901
125 Ga0207703_10036629
126 Ga0268266_10115735
127 Ga0268264_10019044
128 Ga0265327_10000231
129 Ga0265327_10005704
130 Ga0316576_10085572
131 Ga0307413_10054815
132 Ga0307409_100066097
133 Ga0373948_0001862
134 Ga0373929_0004356
135 Ga0316574_0019127
136 Ga0316574_0136847
137 Ga0373931_0000001
138 Ga0373931_0000019
139 Ga0373937_0006968
140 Ga0373937_0176151
141 Ga0395905_0251215
142 Ga0400483_062577
143 Ga0400483_201997
144 Ga0436365_0279892
145 Ga0436360_0328594
146 Ga0436361_0661258
147 Ga0436362_0295859
148 Ga0436362_0654584
149 Ga0451807_0434801
150 Ga0451843_0041294
151 Ga0439434_0014428
152 Ga0451577_0030454
153 Ga0466966_0051172
154 Ga0466966_0201272
155 Ga0466961_0066673
156 Ga0453684_0051109
157 Ga0466957_0107287
158 Ga0466959_0086816
159 Ga0495651_0013184
160 Ga0495653_0054150
161 Ga0495583_0082383
162 Ga0495608_0033923
163 Ga0495630_0066178
164 Ga0495621_0036904
165 Ga0495667_0001375
166 Ga0495623_0014853
167 Ga0495672_0004275
168 Ga0495675_0099422
169 Ga0495684_0201093
170 Ga0496104_0043862
171 Ga0496110_0030567
172 Ga0496110_0071133
173 Ga0496114_0028203
174 Ga0496114_0319391
175 Ga0501032_0008937
176 Ga0501034_0000034
177 Ga0501034_0004646
178 Ga0501034_0005858
179 Ga0501037_0002953
180 Ga0501037_0019964
181 Ga0501041_0107234
182 Ga0501041_0127434
183 Ga0501042_0189158
184 Ga0501068_0000047
185 Ga0501068_0023089
186 Ga0501069_0000874
187 Ga0501070_0000008
188 Ga0501070_0045591
189 Ga0501071_0008464
190 Ga0501071_0023990
191 Ga0501073_0004975
192 Ga0501073_0071753
193 Ga0501074_0021901
194 Ga0501076_0114885
195 Ga0501080_0002411
196 Ga0501080_0094562
197 Ga0501080_0139932
198 Ga0501081_0101122
199 Ga0501083_0042012
200 nmdc:mga03n38_76043_c1
201 nmdc:mga00v17_14049_c1
202 nmdc:mga0yw44_74314_c1
203 nmdc:mga0yw44_836_c1
204 nmdc:mga08y16_317316_c1
205 Ga0495595_0053832
206 Ga0500568_0000022
207 Ga0501084_0022223
208 Ga0501082_0062165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12890

DHOase

Dihydro-orotase-like

49

239

0.87

PF01979

Amidohydro_1

Amidohydrolase family

51

457

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bjh-assembly1.cif.gz_A crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) 0.9335 8 412
3d6n-assembly1.cif.gz_A crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase 0.933 8 415
2z00-assembly1.cif.gz_A crystal structure of dihydroorotase from thermus thermophilus 0.9289 9 418
4yiw-assembly1.cif.gz_A dihydroorotase from bacillus anthracis with substrate bound 0.9237 9 421
3gri-assembly1.cif.gz_A the crystal structure of a dihydroorotase from staphylococcus aureus 0.9171 9 416
ID Description Score Start End Superfamily
af_P9WHL3_52_363_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9616 61 365 3.20.20.140
4bjhA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9504 61 365 3.20.20.140
1gkpC01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9487 9 60 2.30.40.10
2z00A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9421 61 365 3.20.20.140
af_P9WHL3_52_363_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9376 61 365 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7Y3L8J5-F1-model_v4 Amidohydrolase family protein 0.9717 7 251 GO:0004038
GO:0005737
GO:0006145
AF-X1RY00-F1-model_v4 Dihydroorotase bacterial domain-containing protein 0.9647 154 249
AF-A0A524PXK2-F1-model_v4 Dihydroorotase 0.9638 8 344 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872
AF-A0A3S1JL37-F1-model_v4 Dihydroorotase (EC 3.5.2.3) 0.9614 60 341 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872
AF-A0A7V0ISP0-F1-model_v4 Dihydroorotase 0.9608 7 265 GO:0004038
GO:0005737
GO:0006145

Map