F033758

General Info

Members Datasets Scaffolds Average Seq Length
105 35 210 279

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0004873|Ga0453684_0004873_17026_17964
Length 312
Sequence LNIITILRNRAKSKELRNVQQPKQQQQYKLNSMKFDFSDLKGKVAVITGGAGVIGYSICEAMASSGIKTAIIDINKEAAENTAKQLTEKFKVECIGVEASVLDKQSLIAAKKVINEKLGDIDILINGAGGNSPKATTQVEQLTDLADLEKSFFGLEMDGFDKVFALNFNGTLLPSMVFTGDMLKKQKGVVLNISSMNSFRPLTKIPAYSAAKASINNFTQWLAVHLAKTGIRVNAIAPGFFLTNQNRFLLTDEKTGAPTARGLKIISNTPVGKYGKPEDLQGATLFLLSDLSQFITGIILPVDGGYSAFGGV

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
4 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
5 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
6 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
7 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
8 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
9 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
10 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
11 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
12 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
13 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
14 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
15 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
16 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
17 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
18 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
19 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
20 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
21 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
22 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
23 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
24 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
25 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
26 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
27 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
28 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
29 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
30 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
31 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
32 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
33 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
34 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
35 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0004873 3300044712 Bacteria 27512
2 Ga0081539_10000694 3300005985 Bacteria 67521
3 Ga0105243_10121199 3300009148 Unclassified 2205
4 Ga0157372_10012503 3300013307 Bacteria 9046
5 Ga0265337_1001936 3300028556 Bacteria 9846
6 Ga0265323_10018301 3300028653 Bacteria 2712
7 Ga0265323_10061038 3300028653 Unclassified 1311
8 Ga0265338_10019667 3300028800 Bacteria 7147
9 Ga0265338_10390808 3300028800 Bacteria 993
10 Ga0265330_10013264 3300031235 Bacteria 3844
11 Ga0265332_10033495 3300031238 Bacteria 2236
12 Ga0265325_10001186 3300031241 Bacteria 18578
13 Ga0265331_10003053 3300031250 Bacteria 10993
14 Ga0265316_10007690 3300031344 Bacteria 10107
15 Ga0265316_10023948 3300031344 Bacteria 5127
16 Ga0265316_10196449 3300031344 Bacteria 1497
17 Ga0265314_10000009 3300031711 Bacteria 476805
18 Ga0265342_10002019 3300031712 Bacteria 18043
19 Ga0316576_10062885 3300031727 Bacteria 2723
20 Ga0316576_10254855 3300031727 Unclassified 1317
21 Ga0316578_10045155 3300031728 Unclassified 2564
22 Ga0316578_10329248 3300031728 Bacteria 911
23 Ga0316577_10015038 3300031733 Bacteria 4254
24 Ga0316583_10059419 3300032133 Unclassified 1341
25 Ga0316580_10029228 3300032139 Unclassified 1705
26 Ga0316582_0180989 3300036647 Unclassified 1434
27 Ga0316582_0458082 3300036647 Unclassified 879
28 Ga0316584_0001939 3300036712 Bacteria 12902
29 Ga0400488_58122 3300038741 Bacteria 1599
30 Ga0400483_201141 3300039062 Bacteria 16015
31 Ga0400489_06018 3300039093 Unclassified 2126
32 Ga0400489_74766 3300039093 Bacteria 10191
33 Ga0400489_83775 3300039093 Bacteria 1267
34 Ga0451577_0001472 3300042876 Bacteria 31282
35 Ga0451577_0005214 3300042876 Bacteria 13375
36 Ga0451577_0007660 3300042876 Bacteria 10588
37 Ga0451577_0016181 3300042876 Bacteria 6914
38 Ga0451577_0064629 3300042876 Bacteria 3263
39 Ga0451577_0084091 3300042876 Bacteria 2840
40 Ga0451577_0084874 3300042876 Bacteria 2826
41 Ga0451577_0197235 3300042876 Unclassified 1817
42 Ga0451577_0205699 3300042876 Bacteria 1777
43 Ga0451577_0307195 3300042876 Bacteria 1437
44 Ga0451577_0310152 3300042876 Bacteria 1430
45 Ga0451577_0495975 3300042876 Bacteria 1109
46 Ga0453683_0000005 3300044673 Bacteria 741657
47 Ga0453683_0000424 3300044673 Bacteria 48806
48 Ga0453683_0012292 3300044673 Bacteria 5611
49 Ga0453683_0043207 3300044673 Bacteria 2828
50 Ga0453683_0080941 3300044673 Bacteria 2034
51 Ga0453683_0086336 3300044673 Bacteria 1966
52 Ga0453683_0129385 3300044673 Bacteria 1590
53 Ga0453683_0214651 3300044673 Unclassified 1223
54 Ga0453683_0245435 3300044673 Bacteria 1141
55 Ga0453683_0345667 3300044673 Bacteria 955
56 Ga0453684_0000328 3300044712 Bacteria 199181
57 Ga0453684_0000688 3300044712 Bacteria 120333
58 Ga0453684_0001454 3300044712 Bacteria 67293
59 Ga0453684_0002122 3300044712 Bacteria 49971
60 Ga0453684_0003498 3300044712 Bacteria 35258
61 Ga0453684_0008515 3300044712 Bacteria 18333
62 Ga0453684_0012833 3300044712 Bacteria 13732
63 Ga0453684_0020034 3300044712 Bacteria 10130
64 Ga0453684_0026007 3300044712 Bacteria 8474
65 Ga0453684_0026888 3300044712 Bacteria 8289
66 Ga0453684_0032764 3300044712 Bacteria 7260
67 Ga0453684_0033414 3300044712 Bacteria 7173
68 Ga0453684_0055792 3300044712 Bacteria 5133
69 Ga0453684_0078080 3300044712 Bacteria 4145
70 Ga0453684_0079238 3300044712 Bacteria 4107
71 Ga0453684_0088523 3300044712 Bacteria 3834
72 Ga0453684_0093756 3300044712 Bacteria 3697
73 Ga0453684_0095085 3300044712 Bacteria 3663
74 Ga0453684_0099054 3300044712 Bacteria 3572
75 Ga0453684_0100059 3300044712 Bacteria 3549
76 Ga0453684_0171828 3300044712 Bacteria 2553
77 Ga0453684_0193161 3300044712 Bacteria 2380
78 Ga0453684_0221247 3300044712 Bacteria 2193
79 Ga0453684_0222609 3300044712 Bacteria 2185
80 Ga0453684_0231452 3300044712 Bacteria 2133
81 Ga0453684_0282554 3300044712 Bacteria 1892
82 Ga0453684_0283465 3300044712 Bacteria 1889
83 Ga0453684_0341053 3300044712 Bacteria 1692
84 Ga0453684_0368730 3300044712 Unclassified 1615
85 Ga0453684_0754682 3300044712 Bacteria 1053
86 Ga0453684_0821025 3300044712 Bacteria 1001
87 Ga0453684_0950371 3300044712 Unclassified 917
88 Ga0451576_0000190 3300045051 Bacteria 154484
89 Ga0451576_0000613 3300045051 Bacteria 74967
90 Ga0451576_0000889 3300045051 Bacteria 56799
91 Ga0451576_0002068 3300045051 Bacteria 31466
92 Ga0451576_0018045 3300045051 Bacteria 7743
93 Ga0451576_0087585 3300045051 Bacteria 3239
94 Ga0451576_0154402 3300045051 Bacteria 2394
95 Ga0451576_0159407 3300045051 Unclassified 2354
96 Ga0451576_0183032 3300045051 Bacteria 2187
97 Ga0501072_0110509 3300049588 Bacteria 2188
98 Ga0501074_0196118 3300049590 Bacteria 1439
99 Ga0501075_0006236 3300049591 Bacteria 8196
100 Ga0501076_0172071 3300049592 Bacteria 1765
101 Ga0501076_0492514 3300049592 Bacteria 1010
102 Ga0501045_0290165 3300049824 Bacteria 1217
103 nmdc:mga09592_249202_c1 3300050508 Unclassified 1539
104 Ga0501082_0054279 3300060353 Unclassified 3454
105 Ga0530510_0037670 3300061734 Bacteria 3490
106 Ga0453684_0004873
107 Ga0081539_10000694
108 Ga0105243_10121199
109 Ga0157372_10012503
110 Ga0265337_1001936
111 Ga0265323_10018301
112 Ga0265323_10061038
113 Ga0265338_10019667
114 Ga0265338_10390808
115 Ga0265330_10013264
116 Ga0265332_10033495
117 Ga0265325_10001186
118 Ga0265331_10003053
119 Ga0265316_10007690
120 Ga0265316_10023948
121 Ga0265316_10196449
122 Ga0265314_10000009
123 Ga0265342_10002019
124 Ga0316576_10062885
125 Ga0316576_10254855
126 Ga0316578_10045155
127 Ga0316578_10329248
128 Ga0316577_10015038
129 Ga0316583_10059419
130 Ga0316580_10029228
131 Ga0316582_0180989
132 Ga0316582_0458082
133 Ga0316584_0001939
134 Ga0400488_58122
135 Ga0400483_201141
136 Ga0400489_06018
137 Ga0400489_74766
138 Ga0400489_83775
139 Ga0451577_0001472
140 Ga0451577_0005214
141 Ga0451577_0007660
142 Ga0451577_0016181
143 Ga0451577_0064629
144 Ga0451577_0084091
145 Ga0451577_0084874
146 Ga0451577_0197235
147 Ga0451577_0205699
148 Ga0451577_0307195
149 Ga0451577_0310152
150 Ga0451577_0495975
151 Ga0453683_0000005
152 Ga0453683_0000424
153 Ga0453683_0012292
154 Ga0453683_0043207
155 Ga0453683_0080941
156 Ga0453683_0086336
157 Ga0453683_0129385
158 Ga0453683_0214651
159 Ga0453683_0245435
160 Ga0453683_0345667
161 Ga0453684_0000328
162 Ga0453684_0000688
163 Ga0453684_0001454
164 Ga0453684_0002122
165 Ga0453684_0003498
166 Ga0453684_0008515
167 Ga0453684_0012833
168 Ga0453684_0020034
169 Ga0453684_0026007
170 Ga0453684_0026888
171 Ga0453684_0032764
172 Ga0453684_0033414
173 Ga0453684_0055792
174 Ga0453684_0078080
175 Ga0453684_0079238
176 Ga0453684_0088523
177 Ga0453684_0093756
178 Ga0453684_0095085
179 Ga0453684_0099054
180 Ga0453684_0100059
181 Ga0453684_0171828
182 Ga0453684_0193161
183 Ga0453684_0221247
184 Ga0453684_0222609
185 Ga0453684_0231452
186 Ga0453684_0282554
187 Ga0453684_0283465
188 Ga0453684_0341053
189 Ga0453684_0368730
190 Ga0453684_0754682
191 Ga0453684_0821025
192 Ga0453684_0950371
193 Ga0451576_0000190
194 Ga0451576_0000613
195 Ga0451576_0000889
196 Ga0451576_0002068
197 Ga0451576_0018045
198 Ga0451576_0087585
199 Ga0451576_0154402
200 Ga0451576_0159407
201 Ga0451576_0183032
202 Ga0501072_0110509
203 Ga0501074_0196118
204 Ga0501075_0006236
205 Ga0501076_0172071
206 Ga0501076_0492514
207 Ga0501045_0290165
208 nmdc:mga09592_249202_c1
209 Ga0501082_0054279
210 Ga0530510_0037670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

43

254

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

49

307

0.92

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

43

126

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9293 38 299
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9286 38 298
4rzh-assembly1.cif.gz_B crystal structure of fabg from synechocystis sp. pcc 6803 0.9285 37 298
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9275 38 299
1uls-assembly1.cif.gz_A crystal structure of tt0140 from thermus thermophilus hb8 0.9266 39 299
ID Description Score Start End Superfamily
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9187 38 301 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9186 39 299 3.40.50.720
af_Q54PL1_17_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9185 39 302 3.40.50.720
3r1iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9163 29 299 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.915 37 299 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5M8NXY9-F1-model_v4 Putative oxidoreductase UxuB (EC 1.-.-.-) 0.9574 39 231 GO:0016616
AF-U2DJU0-F1-model_v4 3-oxoacyl-acyl-carrier-protein synthase II (EC 2.3.1.179) 0.9565 39 210 GO:0004315
GO:0016491
AF-A0A3N9NVM7-F1-model_v4 SDR family oxidoreductase 0.9392 80 304 GO:0016020
GO:0016616
AF-A0A5M8NXY9-F1-model_v4 Putative oxidoreductase UxuB (EC 1.-.-.-) 0.9339 39 231 GO:0016616
AF-A0A519XI03-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9315 43 217 GO:0016491

Map