F036859

General Info

Members Datasets Scaffolds Average Seq Length
106 89 212 149

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100291190|Ga0070704_1002911903
Length 174
Sequence MSLRCSLSALFLGKAQRKAVTLIVVAVALAVPGLTAGNAAAAPAPKTTVSDVEDEVMCPICGTLLELADSPQARRQKVLIAKLVAEGRTKAEIKDVLVAQYGPAVLAQPEASGFDLTAYLVPILAGLAAALALAFSLMRWRRSGAREPDNGAASQPPRGEEAERLDADLSRYDL

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
57 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
58 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
59 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
62 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
63 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
64 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
65 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
66 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
67 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
68 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
75 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
87 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
88 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
89 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 8.49
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100291190 3300005549 Bacteria 1357
2 Ga0070683_100006361 3300005329 Bacteria 9903
3 Ga0070677_10000004 3300005333 Bacteria 81101
4 Ga0070682_100000013 3300005337 Bacteria 254641
5 Ga0070668_100089032 3300005347 Bacteria 2431
6 Ga0070669_100301743 3300005353 Bacteria 1288
7 Ga0070674_100000029 3300005356 Bacteria 69489
8 Ga0070673_100018841 3300005364 Bacteria 4945
9 Ga0070667_100002484 3300005367 Bacteria 16094
10 Ga0070663_100601215 3300005455 Bacteria 925
11 Ga0070707_100192441 3300005468 Bacteria 1989
12 Ga0070679_100001522 3300005530 Bacteria 20653
13 Ga0070684_100238453 3300005535 Bacteria 1661
14 Ga0068853_100394343 3300005539 Bacteria 1295
15 Ga0070665_100000106 3300005548 Bacteria 157315
16 Ga0068855_100160948 3300005563 Bacteria 2548
17 Ga0068856_100013668 3300005614 Bacteria 7849
18 Ga0068866_10000001 3300005718 Bacteria 519680
19 Ga0068863_100859687 3300005841 Bacteria 906
20 Ga0068858_100000216 3300005842 Bacteria 62188
21 Ga0068858_100069239 3300005842 Bacteria 3271
22 Ga0068860_100097800 3300005843 Bacteria 2799
23 Ga0068862_100007431 3300005844 Bacteria 9083
24 Ga0081455_10022636 3300005937 Bacteria 5867
25 Ga0070715_10000001 3300006163 Bacteria 693690
26 Ga0097621_101491628 3300006237 Unclassified 641
27 Ga0105245_10000016 3300009098 Bacteria 204372
28 Ga0105249_10000068 3300009553 Bacteria 148594
29 Ga0105249_10007460 3300009553 Bacteria 9543
30 Ga0105249_10073074 3300009553 Bacteria 3172
31 Ga0105239_10519052 3300010375 Bacteria 1355
32 Ga0157380_10023719 3300014326 Bacteria 4632
33 Ga0157379_10106307 3300014968 Bacteria 2519
34 Ga0207682_10000031 3300025893 Bacteria 57806
35 Ga0207642_10000002 3300025899 Bacteria 658166
36 Ga0207685_10000036 3300025905 Bacteria 65666
37 Ga0207652_10005524 3300025921 Bacteria 10249
38 Ga0207646_10178871 3300025922 Bacteria 1916
39 Ga0207681_10060562 3300025923 Bacteria 2599
40 Ga0207687_10000018 3300025927 Bacteria 236159
41 Ga0207669_10000012 3300025937 Bacteria 138242
42 Ga0207661_10004878 3300025944 Bacteria 9402
43 Ga0207667_10140347 3300025949 Bacteria 2488
44 Ga0207651_10010923 3300025960 Bacteria 5056
45 Ga0207712_10000007 3300025961 Bacteria 539589
46 Ga0207712_10005452 3300025961 Bacteria 8031
47 Ga0207712_11021680 3300025961 Unclassified 734
48 Ga0207658_10000789 3300025986 Bacteria 26987
49 Ga0207677_10000338 3300026023 Bacteria 33505
50 Ga0207703_10000023 3300026035 Bacteria 222018
51 Ga0207703_10045525 3300026035 Bacteria 3530
52 Ga0207678_10495224 3300026067 Bacteria 1065
53 Ga0207702_10003484 3300026078 Bacteria 14344
54 Ga0207641_10731400 3300026088 Bacteria 976
55 Ga0207683_10458902 3300026121 Bacteria 1175
56 Ga0268266_10000047 3300028379 Bacteria 310996
57 Ga0268265_10008710 3300028380 Bacteria 6860
58 Ga0268264_10006655 3300028381 Bacteria 9721
59 Ga0268264_10286667 3300028381 Bacteria 1545
60 Ga0466963_0000001 3300044694 Bacteria 110556
61 Ga0495592_0447380 3300046454 Bacteria 810
62 Ga0495603_0001695 3300046455 Bacteria 12959
63 Ga0495641_0000044 3300046461 Bacteria 77415
64 Ga0495641_0128645 3300046461 Unclassified 1130
65 Ga0495641_0141558 3300046461 Bacteria 1074
66 Ga0495653_0471613 3300046463 Bacteria 786
67 Ga0495662_0000061 3300046476 Bacteria 37295
68 Ga0495662_0018346 3300046476 Bacteria 3386
69 Ga0495608_0001531 3300046511 Bacteria 16466
70 Ga0495608_0170299 3300046511 Bacteria 1381
71 Ga0495628_0002033 3300046516 Bacteria 18335
72 Ga0495628_0011925 3300046516 Bacteria 7331
73 Ga0495665_0208788 3300046531 Bacteria 1011
74 Ga0495586_0010794 3300046535 Bacteria 4856
75 Ga0495645_0093703 3300046543 Bacteria 2143
76 Ga0495668_0061076 3300046616 Bacteria 2079
77 Ga0495635_0000016 3300046663 Bacteria 214088
78 Ga0495635_0593227 3300046663 Bacteria 724
79 Ga0495657_0037956 3300046675 Bacteria 3316
80 Ga0495599_0002223 3300046678 Bacteria 11296
81 Ga0495647_0000008 3300046681 Bacteria 101193
82 Ga0495647_0001061 3300046681 Bacteria 8370
83 Ga0495647_0263047 3300046681 Bacteria 770
84 Ga0495613_0000203 3300046689 Bacteria 58232
85 Ga0495624_0000008 3300046690 Bacteria 145035
86 Ga0495649_0001624 3300046694 Bacteria 16726
87 Ga0495600_0000779 3300046809 Bacteria 16825
88 Ga0495680_0002092 3300047322 Bacteria 20739
89 Ga0495680_0003005 3300047322 Bacteria 16821
90 Ga0495679_005703 3300047446 Bacteria 5489
91 Ga0495593_0490997 3300047673 Bacteria 615
92 Ga0495602_0011518 3300048088 Bacteria 9138
93 Ga0496100_0000002 3300048903 Bacteria 489057
94 Ga0496101_0000001 3300048904 Bacteria 489057
95 Ga0496104_0000009 3300048907 Bacteria 488055
96 Ga0496105_0000007 3300048908 Bacteria 339658
97 Ga0496106_0000061 3300048909 Bacteria 86524
98 Ga0496107_0000013 3300048910 Bacteria 178284
99 Ga0496107_0161628 3300048910 Bacteria 1660
100 Ga0496109_0000003 3300048912 Bacteria 420862
101 Ga0496114_0024543 3300048917 Bacteria 4923
102 Ga0495601_0000326 3300053077 Bacteria 25282
103 Ga0495612_0001299 3300053078 Bacteria 10313
104 Ga0495595_0000591 3300053084 Bacteria 13851
105 Ga0495619_0488207 3300053085 Unclassified 847
106 Ga0500614_000397 3300053123 Bacteria 11312
107 Ga0070704_100291190
108 Ga0070683_100006361
109 Ga0070677_10000004
110 Ga0070682_100000013
111 Ga0070668_100089032
112 Ga0070669_100301743
113 Ga0070674_100000029
114 Ga0070673_100018841
115 Ga0070667_100002484
116 Ga0070663_100601215
117 Ga0070707_100192441
118 Ga0070679_100001522
119 Ga0070684_100238453
120 Ga0068853_100394343
121 Ga0070665_100000106
122 Ga0068855_100160948
123 Ga0068856_100013668
124 Ga0068866_10000001
125 Ga0068863_100859687
126 Ga0068858_100000216
127 Ga0068858_100069239
128 Ga0068860_100097800
129 Ga0068862_100007431
130 Ga0081455_10022636
131 Ga0070715_10000001
132 Ga0097621_101491628
133 Ga0105245_10000016
134 Ga0105249_10000068
135 Ga0105249_10007460
136 Ga0105249_10073074
137 Ga0105239_10519052
138 Ga0157380_10023719
139 Ga0157379_10106307
140 Ga0207682_10000031
141 Ga0207642_10000002
142 Ga0207685_10000036
143 Ga0207652_10005524
144 Ga0207646_10178871
145 Ga0207681_10060562
146 Ga0207687_10000018
147 Ga0207669_10000012
148 Ga0207661_10004878
149 Ga0207667_10140347
150 Ga0207651_10010923
151 Ga0207712_10000007
152 Ga0207712_10005452
153 Ga0207712_11021680
154 Ga0207658_10000789
155 Ga0207677_10000338
156 Ga0207703_10000023
157 Ga0207703_10045525
158 Ga0207678_10495224
159 Ga0207702_10003484
160 Ga0207641_10731400
161 Ga0207683_10458902
162 Ga0268266_10000047
163 Ga0268265_10008710
164 Ga0268264_10006655
165 Ga0268264_10286667
166 Ga0466963_0000001
167 Ga0495592_0447380
168 Ga0495603_0001695
169 Ga0495641_0000044
170 Ga0495641_0128645
171 Ga0495641_0141558
172 Ga0495653_0471613
173 Ga0495662_0000061
174 Ga0495662_0018346
175 Ga0495608_0001531
176 Ga0495608_0170299
177 Ga0495628_0002033
178 Ga0495628_0011925
179 Ga0495665_0208788
180 Ga0495586_0010794
181 Ga0495645_0093703
182 Ga0495668_0061076
183 Ga0495635_0000016
184 Ga0495635_0593227
185 Ga0495657_0037956
186 Ga0495599_0002223
187 Ga0495647_0000008
188 Ga0495647_0001061
189 Ga0495647_0263047
190 Ga0495613_0000203
191 Ga0495624_0000008
192 Ga0495649_0001624
193 Ga0495600_0000779
194 Ga0495680_0002092
195 Ga0495680_0003005
196 Ga0495679_005703
197 Ga0495593_0490997
198 Ga0495602_0011518
199 Ga0496100_0000002
200 Ga0496101_0000001
201 Ga0496104_0000009
202 Ga0496105_0000007
203 Ga0496106_0000061
204 Ga0496107_0000013
205 Ga0496107_0161628
206 Ga0496109_0000003
207 Ga0496114_0024543
208 Ga0495601_0000326
209 Ga0495612_0001299
210 Ga0495595_0000591
211 Ga0495619_0488207
212 Ga0500614_000397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03918

CcmH

Cytochrome C biogenesis protein

19

169

0.78

Map