F042242

General Info

Members Datasets Scaffolds Average Seq Length
107 82 214 265

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100419453|Ga0070698_1004194531
Length 275
Sequence LIQELFHIGPLSISPFGVMLVVAFLSGFAQLRSGMRQLGIGGEDDASAILFAAGVGGIAGAKIYYALLYHDWHLLFDRAGLVWYGGFLAGAACVLLVLWRRRLPPWRTLDAATPALALGYAIGRIGCFLVGDDYGVPTSLPWGVKFPVGLPPSTAGYLRSEFGVDVPGSIPNDQLLAVHPTQIYETLVALGIWLVGRRLLRRSSTPGDVALPVLAMLAAERFLVEFLRAKDDRWLGVFTLAQAISAVVLIGLLWLWAARRRAPGPSSTVPVKGRA

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
74 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
75 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
77 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
78 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
79 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
80 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
81 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
82 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 92.52
Stem 0
Stem Tuber 0
Unclassified 5.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100419453 3300005471 Bacteria 1273
2 Ga0070677_10056880 3300005333 Bacteria 1601
3 Ga0068869_100593266 3300005334 Bacteria 935
4 Ga0070680_100002863 3300005336 Bacteria 12811
5 Ga0070682_100000002 3300005337 Bacteria 506802
6 Ga0068868_100000058 3300005338 Bacteria 62047
7 Ga0070687_100035313 3300005343 Bacteria 2481
8 Ga0070675_100000001 3300005354 Bacteria 448137
9 Ga0070674_100182390 3300005356 Bacteria 1609
10 Ga0070713_100001495 3300005436 Bacteria 14898
11 Ga0070701_10011273 3300005438 Bacteria 3990
12 Ga0070705_100148839 3300005440 Unclassified 1550
13 Ga0070700_100000016 3300005441 Bacteria 147213
14 Ga0070708_100125380 3300005445 Bacteria 2373
15 Ga0070708_100423779 3300005445 Bacteria 1255
16 Ga0068867_100268930 3300005459 Bacteria 1393
17 Ga0070706_100055277 3300005467 Bacteria 3664
18 Ga0070706_100114745 3300005467 Bacteria 2508
19 Ga0070707_100018811 3300005468 Bacteria 6504
20 Ga0070707_100048971 3300005468 Bacteria 4049
21 Ga0070707_100324598 3300005468 Bacteria 1496
22 Ga0070707_100589644 3300005468 Bacteria 1074
23 Ga0070698_100692193 3300005471 Bacteria 961
24 Ga0070699_100100815 3300005518 Bacteria 2531
25 Ga0070699_100123952 3300005518 Bacteria 2274
26 Ga0070697_100072046 3300005536 Bacteria 2835
27 Ga0070697_100083788 3300005536 Bacteria 2629
28 Ga0070672_100001161 3300005543 Bacteria 16078
29 Ga0070702_100017817 3300005615 Bacteria 3672
30 Ga0068864_100000013 3300005618 Bacteria 326235
31 Ga0068861_100096229 3300005719 Bacteria 2346
32 Ga0068870_10066157 3300005840 Bacteria 1957
33 Ga0068858_100000090 3300005842 Bacteria 94699
34 Ga0070717_10000135 3300006028 Bacteria 54784
35 Ga0075428_100006718 3300006844 Bacteria 12798
36 Ga0075431_100091497 3300006847 Bacteria 3140
37 Ga0075436_100000220 3300006914 Bacteria 35433
38 Ga0105244_10146324 3300009036 Unclassified 1134
39 Ga0105240_10013057 3300009093 Bacteria 11432
40 Ga0111539_10000016 3300009094 Bacteria 276730
41 Ga0105245_10003110 3300009098 Bacteria 14844
42 Ga0105245_10118612 3300009098 Bacteria 2469
43 Ga0114129_10143379 3300009147 Unclassified 3273
44 Ga0105242_10001322 3300009176 Bacteria 19549
45 Ga0105249_10068346 3300009553 Bacteria 3276
46 Ga0105239_10061812 3300010375 Bacteria 4111
47 Ga0157378_10047225 3300013297 Bacteria 3827
48 Ga0157378_10101564 3300013297 Bacteria 2627
49 Ga0157375_10000030 3300013308 Bacteria 199141
50 Ga0157380_10156341 3300014326 Bacteria 1977
51 Ga0213873_10000001 3300021358 Bacteria 1657979
52 Ga0213873_10001032 3300021358 Unclassified 4523
53 Ga0213876_10000002 3300021384 Bacteria 1168769
54 Ga0213876_10000009 3300021384 Bacteria 496136
55 Ga0213876_10079494 3300021384 Bacteria 1733
56 Ga0207643_10063149 3300025908 Bacteria 2117
57 Ga0207695_10018065 3300025913 Bacteria 8164
58 Ga0207660_10008541 3300025917 Bacteria 6627
59 Ga0207662_10050410 3300025918 Bacteria 2473
60 Ga0207646_10486091 3300025922 Bacteria 1113
61 Ga0207646_10643131 3300025922 Bacteria 950
62 Ga0207659_10000004 3300025926 Bacteria 476977
63 Ga0207687_10002760 3300025927 Bacteria 11906
64 Ga0207700_10002725 3300025928 Bacteria 10186
65 Ga0207686_10000773 3300025934 Bacteria 19622
66 Ga0207670_10208473 3300025936 Bacteria 1489
67 Ga0207665_10093289 3300025939 Bacteria 2090
68 Ga0207691_10000515 3300025940 Bacteria 38476
69 Ga0207712_10060297 3300025961 Bacteria 2689
70 Ga0207677_10000004 3300026023 Bacteria 299062
71 Ga0207703_10000242 3300026035 Bacteria 61824
72 Ga0207639_10000008 3300026041 Bacteria 434844
73 Ga0207708_10000005 3300026075 Bacteria 284735
74 Ga0207648_10330922 3300026089 Bacteria 1370
75 Ga0207676_10000014 3300026095 Bacteria 339896
76 Ga0209998_10017906 3300027717 Bacteria 1501
77 Ga0207428_10000020 3300027907 Bacteria 276713
78 Ga0307416_100306579 3300032002 Bacteria 1582
79 Ga0373943_0042729 3300035170 Unclassified 2198
80 Ga0436365_0443328 3300039437 Bacteria 1929
81 Ga0436365_0834263 3300039437 Bacteria 7007
82 Ga0436365_0972791 3300039437 Bacteria 14016
83 Ga0436365_1113771 3300039437 Bacteria 20582
84 Ga0436365_1366402 3300039437 Bacteria 17905
85 Ga0436362_0374793 3300039453 Bacteria 9911
86 Ga0436362_0649416 3300039453 Bacteria 210038
87 Ga0451577_0000356 3300042876 Bacteria 85431
88 Ga0451577_0137068 3300042876 Bacteria 2198
89 Ga0453683_0252869 3300044673 Bacteria 1123
90 Ga0453684_0003146 3300044712 Bacteria 38001
91 Ga0453684_1194234 3300044712 Bacteria 799
92 Ga0451576_0864622 3300045051 Bacteria 949
93 Ga0495620_0001479 3300046515 Bacteria 14051
94 Ga0501073_0001174 3300049589 Bacteria 19124
95 Ga0501080_0218201 3300049742 Unclassified 1746
96 Ga0501080_0870005 3300049742 Bacteria 787
97 Ga0501081_0341317 3300049743 Bacteria 1103
98 nmdc:mga06r32_10742_c1 3300050510 Bacteria 8246
99 nmdc:mga08y16_20_c1 3300050511 Bacteria 276739
100 nmdc:mga0n895_584479_c1 3300050512 Bacteria 1120
101 nmdc:mga0n895_886728_c1 3300050512 Bacteria 878
102 nmdc:mga0rr50_246923_c1 3300050513 Bacteria 1481
103 nmdc:mga0rr50_282_c1 3300050513 Bacteria 27520
104 nmdc:mga0rr50_42080_c1 3300050513 Bacteria 3333
105 nmdc:mga08x19_309_c1 3300050514 Bacteria 35418
106 Ga0495655_0000125 3300053083 Bacteria 14137
107 Ga0530510_0246563 3300061734 Bacteria 1331
108 Ga0070698_100419453
109 Ga0070677_10056880
110 Ga0068869_100593266
111 Ga0070680_100002863
112 Ga0070682_100000002
113 Ga0068868_100000058
114 Ga0070687_100035313
115 Ga0070675_100000001
116 Ga0070674_100182390
117 Ga0070713_100001495
118 Ga0070701_10011273
119 Ga0070705_100148839
120 Ga0070700_100000016
121 Ga0070708_100125380
122 Ga0070708_100423779
123 Ga0068867_100268930
124 Ga0070706_100055277
125 Ga0070706_100114745
126 Ga0070707_100018811
127 Ga0070707_100048971
128 Ga0070707_100324598
129 Ga0070707_100589644
130 Ga0070698_100692193
131 Ga0070699_100100815
132 Ga0070699_100123952
133 Ga0070697_100072046
134 Ga0070697_100083788
135 Ga0070672_100001161
136 Ga0070702_100017817
137 Ga0068864_100000013
138 Ga0068861_100096229
139 Ga0068870_10066157
140 Ga0068858_100000090
141 Ga0070717_10000135
142 Ga0075428_100006718
143 Ga0075431_100091497
144 Ga0075436_100000220
145 Ga0105244_10146324
146 Ga0105240_10013057
147 Ga0111539_10000016
148 Ga0105245_10003110
149 Ga0105245_10118612
150 Ga0114129_10143379
151 Ga0105242_10001322
152 Ga0105249_10068346
153 Ga0105239_10061812
154 Ga0157378_10047225
155 Ga0157378_10101564
156 Ga0157375_10000030
157 Ga0157380_10156341
158 Ga0213873_10000001
159 Ga0213873_10001032
160 Ga0213876_10000002
161 Ga0213876_10000009
162 Ga0213876_10079494
163 Ga0207643_10063149
164 Ga0207695_10018065
165 Ga0207660_10008541
166 Ga0207662_10050410
167 Ga0207646_10486091
168 Ga0207646_10643131
169 Ga0207659_10000004
170 Ga0207687_10002760
171 Ga0207700_10002725
172 Ga0207686_10000773
173 Ga0207670_10208473
174 Ga0207665_10093289
175 Ga0207691_10000515
176 Ga0207712_10060297
177 Ga0207677_10000004
178 Ga0207703_10000242
179 Ga0207639_10000008
180 Ga0207708_10000005
181 Ga0207648_10330922
182 Ga0207676_10000014
183 Ga0209998_10017906
184 Ga0207428_10000020
185 Ga0307416_100306579
186 Ga0373943_0042729
187 Ga0436365_0443328
188 Ga0436365_0834263
189 Ga0436365_0972791
190 Ga0436365_1113771
191 Ga0436365_1366402
192 Ga0436362_0374793
193 Ga0436362_0649416
194 Ga0451577_0000356
195 Ga0451577_0137068
196 Ga0453683_0252869
197 Ga0453684_0003146
198 Ga0453684_1194234
199 Ga0451576_0864622
200 Ga0495620_0001479
201 Ga0501073_0001174
202 Ga0501080_0218201
203 Ga0501080_0870005
204 Ga0501081_0341317
205 nmdc:mga06r32_10742_c1
206 nmdc:mga08y16_20_c1
207 nmdc:mga0n895_584479_c1
208 nmdc:mga0n895_886728_c1
209 nmdc:mga0rr50_246923_c1
210 nmdc:mga0rr50_282_c1
211 nmdc:mga0rr50_42080_c1
212 nmdc:mga08x19_309_c1
213 Ga0495655_0000125
214 Ga0530510_0246563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

3

258

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8295 3 261
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7953 3 261
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.4351 87 257
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.3956 87 257
7szv-assembly1.cif.gz_B-2 crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda 0.3921 89 258
ID Description Score Start End Superfamily
af_Q5SRH9_29_148_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4744 179 259 1.25.40.10
af_Q9FGA7_25_170_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4474 89 257 1.20.140.40
af_O22244_44_204_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4239 85 257 1.20.140.40
af_I1JDC8_29_172_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4229 93 258 1.20.140.40
af_P07510_246_353_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.416 184 270 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A6L8JD43-F1-model_v4 deleted 0.9833 116 259
AF-A0A6N9F0D4-F1-model_v4 deleted 0.9696 94 259
AF-A0A2V7L957-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9404 1 104 GO:0005886
GO:0008961
GO:0042158
AF-A0A2V7G6Y5-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9354 1 256 GO:0005886
GO:0008961
GO:0042158
AF-C6PY81-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9295 119 259 GO:0005886
GO:0008961
GO:0042158

Map