F044080

General Info

Members Datasets Scaffolds Average Seq Length
107 24 214 289

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10005523|Ga0316575_100055232
Length 333
Sequence VFIETSAGTNRCVLDYLRSITCPNLQLPVQSVYDHFGKVATKLLGRKGRNLVTKTERNALIALPIVILXXXGVALAGSQGGASAAGIPIFALCVGLAFLIQWLAFIPAYLLQTEKFLDLTGSLTYITVAAIAVLLSPVVDGRSILLLALVVIWAARLGIFLFRRIQRTGKDSRFDQIKPSFIRFLSFWTLQGLWVTFTAELGLFALIGFLVWAFGFVMETVADVQKNRFRAGPKNKGKFIDSGVWAWSRHPNYFGEIVLWIGVAIIALPVLRGWQWATLISPVFVALLLTRISGVPMLEKRADEKWGGQEDYEAYKKRTPVLIPRPRFSSDGK

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
3 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
4 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
5 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
6 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
7 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
8 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
9 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
10 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
11 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
15 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
16 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
17 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
18 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
19 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
20 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
21 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
22 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
23 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
24 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 3.74
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 15.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10005523 3300031665 Bacteria 4512
2 Ga0265316_10327106 3300031344 Bacteria 1113
3 Ga0307408_100001583 3300031548 Bacteria 16796
4 Ga0316575_10003817 3300031665 Bacteria 5249
5 Ga0316575_10040304 3300031665 Unclassified 1845
6 Ga0316579_10013574 3300031691 Bacteria 3506
7 Ga0316579_10020284 3300031691 Unclassified 2947
8 Ga0316579_10035881 3300031691 Bacteria 2286
9 Ga0316579_10058948 3300031691 Bacteria 1804
10 Ga0316579_10060949 3300031691 Bacteria 1775
11 Ga0316579_10126304 3300031691 Bacteria 1231
12 Ga0316576_10036603 3300031727 Bacteria 3508
13 Ga0316576_10046016 3300031727 Unclassified 3157
14 Ga0316576_10092728 3300031727 Bacteria 2251
15 Ga0316576_10121994 3300031727 Unclassified 1958
16 Ga0316576_10136408 3300031727 Bacteria 1847
17 Ga0316578_10072891 3300031728 Unclassified 2034
18 Ga0316578_10205930 3300031728 Bacteria 1184
19 Ga0316577_10000542 3300031733 Bacteria 15263
20 Ga0316577_10001072 3300031733 Bacteria 12382
21 Ga0316577_10004884 3300031733 Bacteria 6979
22 Ga0316577_10013602 3300031733 Bacteria 4455
23 Ga0316577_10017856 3300031733 Unclassified 3921
24 Ga0316577_10020027 3300031733 Bacteria 3706
25 Ga0316577_10026351 3300031733 Bacteria 3237
26 Ga0316577_10028942 3300031733 Bacteria 3092
27 Ga0316577_10107782 3300031733 Bacteria 1563
28 Ga0316577_10113939 3300031733 Unclassified 1517
29 Ga0307412_10001890 3300031911 Bacteria 11589
30 Ga0316585_10006709 3300032137 Bacteria 3296
31 Ga0316585_10043228 3300032137 Unclassified 1438
32 Ga0316580_10007122 3300032139 Bacteria 3321
33 Ga0316580_10061753 3300032139 Bacteria 1150
34 Ga0316593_10012081 3300032168 Unclassified 2527
35 Ga0316593_10014313 3300032168 Bacteria 2363
36 Ga0316587_1000383 3300033529 Bacteria 4304
37 Ga0316596_1011303 3300033541 Bacteria 2179
38 Ga0316574_0008327 3300035398 Bacteria 5753
39 Ga0316574_0012485 3300035398 Bacteria 4860
40 Ga0316574_0064234 3300035398 Unclassified 2309
41 Ga0316574_0068387 3300035398 Bacteria 2240
42 Ga0316582_0001802 3300036647 Bacteria 9671
43 Ga0316582_0012057 3300036647 Bacteria 4810
44 Ga0316582_0036563 3300036647 Bacteria 3040
45 Ga0316582_0051078 3300036647 Bacteria 2622
46 Ga0316582_0065281 3300036647 Bacteria 2343
47 Ga0316582_0110899 3300036647 Bacteria 1826
48 Ga0316582_0111587 3300036647 Bacteria 1821
49 Ga0316582_0258029 3300036647 Bacteria 1195
50 Ga0316582_0370777 3300036647 Bacteria 985
51 Ga0316584_0003113 3300036712 Bacteria 10715
52 Ga0316584_0034796 3300036712 Bacteria 3735
53 Ga0316584_0043181 3300036712 Bacteria 3361
54 Ga0316584_0047295 3300036712 Bacteria 3214
55 Ga0316584_0097970 3300036712 Bacteria 2195
56 Ga0316584_0133447 3300036712 Bacteria 1854
57 Ga0316584_0152767 3300036712 Unclassified 1718
58 Ga0316584_0198803 3300036712 Bacteria 1480
59 Ga0316584_0261008 3300036712 Bacteria 1263
60 Ga0316584_0335220 3300036712 Unclassified 1088
61 Ga0316584_0363040 3300036712 Bacteria 1038
62 Ga0316584_0394122 3300036712 Bacteria 987
63 Ga0316581_0010877 3300037588 Bacteria 2533
64 Ga0316581_0019362 3300037588 Bacteria 1984
65 Ga0316581_0064556 3300037588 Bacteria 1124
66 Ga0400484_23185 3300038725 Bacteria 1094
67 Ga0400489_41191 3300039093 Bacteria 8731
68 Ga0400489_60604 3300039093 Bacteria 3847
69 Ga0400489_71322 3300039093 Bacteria 2476
70 Ga0451577_0008215 3300042876 Bacteria 10174
71 Ga0451577_0010271 3300042876 Bacteria 8963
72 Ga0451577_0132452 3300042876 Bacteria 2237
73 Ga0451577_0457539 3300042876 Bacteria 1159
74 Ga0453683_0000747 3300044673 Bacteria 32801
75 Ga0453683_0009711 3300044673 Bacteria 6415
76 Ga0453683_0010666 3300044673 Bacteria 6085
77 Ga0453683_0076256 3300044673 Unclassified 2099
78 Ga0453683_0139868 3300044673 Unclassified 1527
79 Ga0453684_0000344 3300044712 Bacteria 192860
80 Ga0453684_0000859 3300044712 Bacteria 102253
81 Ga0453684_0001674 3300044712 Bacteria 59980
82 Ga0453684_0002098 3300044712 Bacteria 50342
83 Ga0453684_0005094 3300044712 Bacteria 26501
84 Ga0453684_0006513 3300044712 Bacteria 22129
85 Ga0453684_0016694 3300044712 Bacteria 11451
86 Ga0453684_0024120 3300044712 Bacteria 8910
87 Ga0453684_0025455 3300044712 Bacteria 8591
88 Ga0453684_0028829 3300044712 Bacteria 7903
89 Ga0453684_0032190 3300044712 Bacteria 7347
90 Ga0453684_0036314 3300044712 Bacteria 6792
91 Ga0453684_0039962 3300044712 Bacteria 6380
92 Ga0453684_0058453 3300044712 Bacteria 4981
93 Ga0453684_0122617 3300044712 Bacteria 3135
94 Ga0453684_0196189 3300044712 Unclassified 2357
95 Ga0453684_0197041 3300044712 Bacteria 2351
96 Ga0453684_0202533 3300044712 Unclassified 2313
97 Ga0453684_0231584 3300044712 Bacteria 2132
98 Ga0453684_0259777 3300044712 Bacteria 1990
99 Ga0453684_0320371 3300044712 Unclassified 1756
100 Ga0453684_0388828 3300044712 Bacteria 1565
101 Ga0453684_0437796 3300044712 Bacteria 1457
102 Ga0453684_0444354 3300044712 Bacteria 1444
103 Ga0453684_0766246 3300044712 Bacteria 1043
104 Ga0451576_0000009 3300045051 Bacteria 712666
105 Ga0451576_0004888 3300045051 Bacteria 17124
106 Ga0451576_0043411 3300045051 Bacteria 4744
107 8055040374 8055037949 Bacteria 3337834
108 Ga0316575_10005523
109 Ga0265316_10327106
110 Ga0307408_100001583
111 Ga0316575_10003817
112 Ga0316575_10040304
113 Ga0316579_10013574
114 Ga0316579_10020284
115 Ga0316579_10035881
116 Ga0316579_10058948
117 Ga0316579_10060949
118 Ga0316579_10126304
119 Ga0316576_10036603
120 Ga0316576_10046016
121 Ga0316576_10092728
122 Ga0316576_10121994
123 Ga0316576_10136408
124 Ga0316578_10072891
125 Ga0316578_10205930
126 Ga0316577_10000542
127 Ga0316577_10001072
128 Ga0316577_10004884
129 Ga0316577_10013602
130 Ga0316577_10017856
131 Ga0316577_10020027
132 Ga0316577_10026351
133 Ga0316577_10028942
134 Ga0316577_10107782
135 Ga0316577_10113939
136 Ga0307412_10001890
137 Ga0316585_10006709
138 Ga0316585_10043228
139 Ga0316580_10007122
140 Ga0316580_10061753
141 Ga0316593_10012081
142 Ga0316593_10014313
143 Ga0316587_1000383
144 Ga0316596_1011303
145 Ga0316574_0008327
146 Ga0316574_0012485
147 Ga0316574_0064234
148 Ga0316574_0068387
149 Ga0316582_0001802
150 Ga0316582_0012057
151 Ga0316582_0036563
152 Ga0316582_0051078
153 Ga0316582_0065281
154 Ga0316582_0110899
155 Ga0316582_0111587
156 Ga0316582_0258029
157 Ga0316582_0370777
158 Ga0316584_0003113
159 Ga0316584_0034796
160 Ga0316584_0043181
161 Ga0316584_0047295
162 Ga0316584_0097970
163 Ga0316584_0133447
164 Ga0316584_0152767
165 Ga0316584_0198803
166 Ga0316584_0261008
167 Ga0316584_0335220
168 Ga0316584_0363040
169 Ga0316584_0394122
170 Ga0316581_0010877
171 Ga0316581_0019362
172 Ga0316581_0064556
173 Ga0400484_23185
174 Ga0400489_41191
175 Ga0400489_60604
176 Ga0400489_71322
177 Ga0451577_0008215
178 Ga0451577_0010271
179 Ga0451577_0132452
180 Ga0451577_0457539
181 Ga0453683_0000747
182 Ga0453683_0009711
183 Ga0453683_0010666
184 Ga0453683_0076256
185 Ga0453683_0139868
186 Ga0453684_0000344
187 Ga0453684_0000859
188 Ga0453684_0001674
189 Ga0453684_0002098
190 Ga0453684_0005094
191 Ga0453684_0006513
192 Ga0453684_0016694
193 Ga0453684_0024120
194 Ga0453684_0025455
195 Ga0453684_0028829
196 Ga0453684_0032190
197 Ga0453684_0036314
198 Ga0453684_0039962
199 Ga0453684_0058453
200 Ga0453684_0122617
201 Ga0453684_0196189
202 Ga0453684_0197041
203 Ga0453684_0202533
204 Ga0453684_0231584
205 Ga0453684_0259777
206 Ga0453684_0320371
207 Ga0453684_0388828
208 Ga0453684_0437796
209 Ga0453684_0444354
210 Ga0453684_0766246
211 Ga0451576_0000009
212 Ga0451576_0004888
213 Ga0451576_0043411
214 8055040374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

104

319

0.96

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

184

294

0.75

PF02544

Steroid_dh

3-oxo-5-alpha-steroid 4-dehydrogenase

178

325

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5587 22 270
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5539 22 271
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.5489 12 270
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5451 22 270
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5406 22 271
ID Description Score Start End Superfamily
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9707 73 271 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.966 73 271 1.20.120.1630
af_I1KQJ7_60_258_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9538 75 271 1.20.120.1630
af_I1KQJ7_60_258_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.94 75 271 1.20.120.1630
af_Q54W87_65_266_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9347 75 272 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A2E6UND9-F1-model_v4 Uncharacterized protein 0.9912 13 271 GO:0016020
AF-A0A2E4PTU1-F1-model_v4 Uncharacterized protein 0.9901 13 273 GO:0016020
AF-A0A420WK32-F1-model_v4 Steroid 5-alpha reductase family enzyme 0.9891 13 272 GO:0016020
AF-A0A7S2S2V5-F1-model_v4 Steroid 5-alpha reductase C-terminal domain-containing protein 0.9875 154 272 GO:0016020
AF-B7RTR0-F1-model_v4 Uncharacterized protein 0.9859 13 271 GO:0016020

Map