F044658

General Info

Members Datasets Scaffolds Average Seq Length
107 34 214 164

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0286216|Ga0451577_0286216_863_1438
Length 191
Sequence MPNKIDNMEAVLSLSNIFTEGRMADLKGSKTEAGLLEAFAGESQANRKYLAFAEKAEQEGYTAAARLFRAAAAAETVHAXXHLRALGGIRTTADNLREALGGETHEFTTMYPQMIADATDEGFDNAHRSFRFANAVEKVHAALYQKAIDNLGQNVLVDYYVCKVCGNTVEGAPHGPCAVCQALPAAFFKID

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
3 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
4 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
5 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
6 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
7 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
8 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
9 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
10 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
11 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
12 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
13 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
14 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
19 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
20 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
21 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
22 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
23 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
24 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
25 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
26 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
27 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
28 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
29 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
30 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
31 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
32 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
33 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
34 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.18
Metatranscriptomes 16.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 5.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0286216 3300042876 Bacteria 1493
2 Ga0265338_10085073 3300028800 Unclassified 2637
3 Ga0265338_10280589 3300028800 Archaea 1217
4 Ga0265324_10002675 3300029957 Bacteria 8890
5 Ga0265328_10010322 3300031239 Bacteria 3764
6 Ga0265320_10052940 3300031240 Bacteria 1963
7 Ga0265331_10003390 3300031250 Bacteria 10327
8 Ga0265327_10000398 3300031251 Bacteria 81338
9 Ga0265327_10148580 3300031251 Bacteria 1090
10 Ga0307509_10555165 3300031507 Bacteria 826
11 Ga0316579_10150807 3300031691 Bacteria 1122
12 Ga0316579_10401356 3300031691 Bacteria 663
13 Ga0265314_10022943 3300031711 Bacteria 4771
14 Ga0316576_10365263 3300031727 Bacteria 1073
15 Ga0316578_10150435 3300031728 Bacteria 1402
16 Ga0316577_10360860 3300031733 Bacteria 825
17 Ga0316593_10030981 3300032168 Bacteria 1740
18 Ga0316593_10047693 3300032168 Bacteria 1441
19 Ga0316593_10085682 3300032168 Bacteria 1104
20 Ga0316593_10086379 3300032168 Bacteria 1100
21 Ga0316593_10102714 3300032168 Bacteria 1015
22 Ga0316593_10119240 3300032168 Bacteria 946
23 Ga0316593_10129918 3300032168 Bacteria 908
24 Ga0316593_10178101 3300032168 Unclassified 781
25 Ga0316593_10214337 3300032168 Bacteria 714
26 Ga0316593_10225697 3300032168 Unclassified 697
27 Ga0316593_10253754 3300032168 Bacteria 659
28 Ga0316592_1031445 3300033524 Bacteria 1156
29 Ga0316592_1065078 3300033524 Bacteria 821
30 Ga0316586_1049575 3300033527 Bacteria 750
31 Ga0316596_1013914 3300033541 Bacteria 1989
32 Ga0316596_1091214 3300033541 Bacteria 821
33 Ga0316596_1096578 3300033541 Bacteria 798
34 Ga0316596_1100922 3300033541 Bacteria 780
35 Ga0316574_0082853 3300035398 Unclassified 2039
36 Ga0316582_0127511 3300036647 Bacteria 1707
37 Ga0316582_0711595 3300036647 Bacteria 690
38 Ga0316581_0052863 3300037588 Unclassified 1245
39 Ga0400490_55395 3300038726 Bacteria 94145
40 Ga0400486_25436 3300038742 Bacteria 15320
41 Ga0400483_137949 3300039062 Bacteria 72420
42 Ga0400489_17909 3300039093 Bacteria 1824
43 Ga0400489_35896 3300039093 Bacteria 3596
44 Ga0400489_60006 3300039093 Unclassified 3322
45 Ga0400487_38301 3300039110 Bacteria 1000
46 Ga0451577_0000099 3300042876 Bacteria 191842
47 Ga0451577_0000193 3300042876 Bacteria 128594
48 Ga0451577_0016237 3300042876 Bacteria 6899
49 Ga0451577_0017890 3300042876 Bacteria 6539
50 Ga0451577_0032007 3300042876 Bacteria 4740
51 Ga0451577_0035357 3300042876 Bacteria 4500
52 Ga0451577_0173930 3300042876 Bacteria 1940
53 Ga0451577_0190195 3300042876 Bacteria 1851
54 Ga0451577_0395674 3300042876 Bacteria 1254
55 Ga0451577_0408216 3300042876 Bacteria 1233
56 Ga0451577_0411328 3300042876 Bacteria 1228
57 Ga0451577_0524370 3300042876 Bacteria 1076
58 Ga0451577_0597490 3300042876 Bacteria 1001
59 Ga0451577_1261862 3300042876 Bacteria 658
60 Ga0451577_1611987 3300042876 Bacteria 572
61 Ga0453683_0000056 3300044673 Bacteria 192299
62 Ga0453683_0046961 3300044673 Bacteria 2706
63 Ga0453683_0069695 3300044673 Bacteria 2198
64 Ga0453683_0098643 3300044673 Bacteria 1834
65 Ga0453683_0477941 3300044673 Bacteria 807
66 Ga0453684_0000003 3300044712 Bacteria 1481694
67 Ga0453684_0000350 3300044712 Bacteria 191841
68 Ga0453684_0000790 3300044712 Bacteria 108445
69 Ga0453684_0001333 3300044712 Bacteria 72470
70 Ga0453684_0002326 3300044712 Bacteria 46531
71 Ga0453684_0005836 3300044712 Bacteria 23950
72 Ga0453684_0008894 3300044712 Bacteria 17783
73 Ga0453684_0014128 3300044712 Bacteria 12837
74 Ga0453684_0021904 3300044712 Bacteria 9512
75 Ga0453684_0039390 3300044712 Bacteria 6441
76 Ga0453684_0065629 3300044712 Bacteria 4628
77 Ga0453684_0094334 3300044712 Bacteria 3681
78 Ga0453684_0170845 3300044712 Bacteria 2562
79 Ga0453684_0255198 3300044712 Bacteria 2011
80 Ga0453684_0325519 3300044712 Bacteria 1739
81 Ga0453684_0354054 3300044712 Bacteria 1654
82 Ga0453684_0627408 3300044712 Bacteria 1175
83 Ga0453684_0666851 3300044712 Bacteria 1133
84 Ga0453684_0877009 3300044712 Bacteria 962
85 Ga0453684_1001855 3300044712 Bacteria 888
86 Ga0453684_1047232 3300044712 Bacteria 865
87 Ga0453684_1057253 3300044712 Bacteria 860
88 Ga0453684_1868930 3300044712 Bacteria 608
89 Ga0451576_0000138 3300045051 Bacteria 185167
90 Ga0451576_0000207 3300045051 Bacteria 147627
91 Ga0451576_0021015 3300045051 Bacteria 7101
92 Ga0451576_0043803 3300045051 Bacteria 4720
93 Ga0451576_0134785 3300045051 Bacteria 2575
94 Ga0451576_0168414 3300045051 Bacteria 2286
95 Ga0451576_0202853 3300045051 Bacteria 2071
96 Ga0451576_0256918 3300045051 Bacteria 1826
97 Ga0451576_0318094 3300045051 Bacteria 1628
98 Ga0451576_0328740 3300045051 Bacteria 1600
99 Ga0451576_0393667 3300045051 Bacteria 1452
100 Ga0451576_0874083 3300045051 Bacteria 943
101 Ga0451576_0876740 3300045051 Bacteria 942
102 Ga0496104_0210456 3300048907 Bacteria 1856
103 Ga0501036_0218951 3300049572 Bacteria 1599
104 Ga0501039_0687084 3300049575 Bacteria 801
105 Ga0501041_0349313 3300049577 Bacteria 935
106 Ga0501075_0446082 3300049591 Bacteria 987
107 Ga0530510_0026746 3300061734 Bacteria 4131
108 Ga0451577_0286216
109 Ga0265338_10085073
110 Ga0265338_10280589
111 Ga0265324_10002675
112 Ga0265328_10010322
113 Ga0265320_10052940
114 Ga0265331_10003390
115 Ga0265327_10000398
116 Ga0265327_10148580
117 Ga0307509_10555165
118 Ga0316579_10150807
119 Ga0316579_10401356
120 Ga0265314_10022943
121 Ga0316576_10365263
122 Ga0316578_10150435
123 Ga0316577_10360860
124 Ga0316593_10030981
125 Ga0316593_10047693
126 Ga0316593_10085682
127 Ga0316593_10086379
128 Ga0316593_10102714
129 Ga0316593_10119240
130 Ga0316593_10129918
131 Ga0316593_10178101
132 Ga0316593_10214337
133 Ga0316593_10225697
134 Ga0316593_10253754
135 Ga0316592_1031445
136 Ga0316592_1065078
137 Ga0316586_1049575
138 Ga0316596_1013914
139 Ga0316596_1091214
140 Ga0316596_1096578
141 Ga0316596_1100922
142 Ga0316574_0082853
143 Ga0316582_0127511
144 Ga0316582_0711595
145 Ga0316581_0052863
146 Ga0400490_55395
147 Ga0400486_25436
148 Ga0400483_137949
149 Ga0400489_17909
150 Ga0400489_35896
151 Ga0400489_60006
152 Ga0400487_38301
153 Ga0451577_0000099
154 Ga0451577_0000193
155 Ga0451577_0016237
156 Ga0451577_0017890
157 Ga0451577_0032007
158 Ga0451577_0035357
159 Ga0451577_0173930
160 Ga0451577_0190195
161 Ga0451577_0395674
162 Ga0451577_0408216
163 Ga0451577_0411328
164 Ga0451577_0524370
165 Ga0451577_0597490
166 Ga0451577_1261862
167 Ga0451577_1611987
168 Ga0453683_0000056
169 Ga0453683_0046961
170 Ga0453683_0069695
171 Ga0453683_0098643
172 Ga0453683_0477941
173 Ga0453684_0000003
174 Ga0453684_0000350
175 Ga0453684_0000790
176 Ga0453684_0001333
177 Ga0453684_0002326
178 Ga0453684_0005836
179 Ga0453684_0008894
180 Ga0453684_0014128
181 Ga0453684_0021904
182 Ga0453684_0039390
183 Ga0453684_0065629
184 Ga0453684_0094334
185 Ga0453684_0170845
186 Ga0453684_0255198
187 Ga0453684_0325519
188 Ga0453684_0354054
189 Ga0453684_0627408
190 Ga0453684_0666851
191 Ga0453684_0877009
192 Ga0453684_1001855
193 Ga0453684_1047232
194 Ga0453684_1057253
195 Ga0453684_1868930
196 Ga0451576_0000138
197 Ga0451576_0000207
198 Ga0451576_0021015
199 Ga0451576_0043803
200 Ga0451576_0134785
201 Ga0451576_0168414
202 Ga0451576_0202853
203 Ga0451576_0256918
204 Ga0451576_0318094
205 Ga0451576_0328740
206 Ga0451576_0393667
207 Ga0451576_0874083
208 Ga0451576_0876740
209 Ga0496104_0210456
210 Ga0501036_0218951
211 Ga0501039_0687084
212 Ga0501041_0349313
213 Ga0501075_0446082
214 Ga0530510_0026746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02915

Rubrerythrin

Rubrerythrin

34

148

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4di0-assembly1.cif.gz_A the structure of rubrerythrin from burkholderia pseudomallei 0.9569 1 121
7o91-assembly2.cif.gz_B dimn-sulerythrin 0.9514 1 121
1j30-assembly1.cif.gz_B the crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon 0.9472 1 120
7o91-assembly1.cif.gz_A dimn-sulerythrin 0.9295 1 127
2hr5-assembly1.cif.gz_A pf1283- rubrerythrin from pyrococcus furiosus iron bound form 0.9201 1 160
ID Description Score Start End Superfamily
af_Q58156_13_77_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9736 1 61 1.20.1260.10
3qvdF01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9621 3 126 1.20.1260.10
3qvdE01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9617 3 126 1.20.1260.10
1nnqA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9608 3 126 1.20.1260.10
3pwfB01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9605 3 126 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A850LSA4-F1-model_v4 Rubrerythrin family protein 1.001 1 119 GO:0016491
GO:0046872
AF-A0A391NQC4-F1-model_v4 Ferritin-like diiron domain-containing protein 1 1 83 GO:0016491
GO:0046872
AF-A0A3D3K4L3-F1-model_v4 Reverse rubrerythrin 0.9917 1 59
AF-A0A2N2M6W6-F1-model_v4 Rubrerythrin 0.9906 1 114 GO:0016491
GO:0046872
AF-A0A847I221-F1-model_v4 Rubrerythrin family protein 0.9885 1 126 GO:0016491
GO:0046872

Map