F046089

General Info

Members Datasets Scaffolds Average Seq Length
107 97 214 488

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057733483|8057739075
Length 543
Sequence SLQAQLDAPPAFFEEYQFSSCSHLWWKRYNNFAEVNPKSTSDTKRQKEKGDMMTEKKAIIETGWNFDNSYACLPKSFFTRLNPTPVPSPKLIILNDALAVSLGLDVQAVQSSTGVAVLAGNQIPEGALPLAQAYAGHQFGHFTMLGDGRAILLGEQITPLGERVDIQLKGSGKTPYSRRGDGLAALGPMLREYIISEAMHALGIATTRSLAVVTTGETVIRETEQPGAILTRVAASHLRVGTFQYVSNWGTAQDLRALADYTLQRHFPEVADEENRYLFLLQEVIKRQAVLIAKWQLVGFIHGVMNTDNMALSGETIDYGPCAFMDAYDPATVFSSIDIHGRYAYGNQPHIAAWNLARFAETLLPLLHDNEVQAVQLAEDAISDFSELYHRKWLAGMRAKLGIFNEELQDESLIEDLLGMMQKYRADYTNTFRELTFDKVEDTALFGTTEFAQWHELWQARLVRQQESKASSHQLMRNSNPAIIPRNHRVEDALEAAVEQGDYSVMERLLDVLSSPYAHSPEQADYSTLPALSTRPYRTFCGT

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
4 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
5 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
6 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
7 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
8 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
9 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
10 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
11 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
13 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
15 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
16 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
17 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
18 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
19 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
20 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
21 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
22 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
23 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
24 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
25 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
26 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
27 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
28 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
29 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
30 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
31 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
32 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
33 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
34 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
35 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
36 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
37 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
38 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
39 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
40 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
41 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
42 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
43 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
44 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
45 2643221576 Nocardioides sp. Root614 Isolate Unclassified
46 2643221590 Nocardioides sp. Root682 Isolate Unclassified
47 2643221604 Nocardioides sp. Root190 Isolate Unclassified
48 2643221617 Nocardioides sp. Root79 Isolate Unclassified
49 2643221620 Nocardioides sp. Root240 Isolate Unclassified
50 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
51 2671180694 Paenibacillus sp. A3 Isolate Unclassified
52 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
53 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
54 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
55 2738541295 Bacillus sp. OK085 Isolate Unclassified
56 2738543010 Bacillus sp. YR335 Isolate Unclassified
57 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
58 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
59 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
60 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
61 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
62 2818991441 Niallia circulans 3243 Isolate Rhizosphere
63 2842682962 Bacillus sp. R-72492 Isolate Unclassified
64 2842882022 Bacillus sp. R-71893 Isolate Unclassified
65 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
66 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
67 2857472729 Cohnella sp. R-74144 Isolate Unclassified
68 2857581216 Bacillus sp. R-71922 Isolate Unclassified
69 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
70 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
71 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
72 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
73 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
74 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
75 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
76 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
77 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
78 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
79 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
80 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
81 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
82 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
83 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
84 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
85 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
86 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
87 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
88 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
89 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
90 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
91 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
92 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
93 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
94 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
95 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
96 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
97 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 42.99
Metatranscriptomes 0
Isolates 57.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.28
Nodule 5.61
Rhizoplane 0.93
Rhizosphere 45.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002081 3300003187 Bacteria 12469
2 JGI25151J46595_10007011 3300003187 Bacteria 5578
3 Ga0055532_1001233 3300003758 Bacteria 7553
4 Ga0075367_10004869 3300006178 Bacteria 6611
5 Ga0079104_1000067 3300006946 Bacteria 155559
6 Ga0079104_1002190 3300006946 Bacteria 11014
7 Ga0079104_1018477 3300006946 Bacteria 1973
8 Ga0105244_10013150 3300009036 Bacteria 4849
9 Ga0105250_10001391 3300009092 Bacteria 13081
10 Ga0157374_10003288 3300013296 Bacteria 13579
11 Ga0209147_100069 3300025229 Bacteria 224017
12 Ga0209147_100516 3300025229 Bacteria 22397
13 Ga0209130_1001947 3300025284 Bacteria 11462
14 Ga0209025_1000043 3300025294 Bacteria 350458
15 Ga0209025_1000863 3300025294 Bacteria 47880
16 Ga0209025_1016976 3300025294 Bacteria 4242
17 Ga0207696_1007837 3300025711 Bacteria 4140
18 Ga0209281_1000150 3300027111 Bacteria 167280
19 Ga0209281_1000470 3300027111 Bacteria 56678
20 Ga0209281_1001472 3300027111 Bacteria 13674
21 Ga0268266_10000673 3300028379 Bacteria 46152
22 Ga0316574_0062106 3300035398 Bacteria 2347
23 Ga0316582_0136385 3300036647 Bacteria 1652
24 Ga0395900_0269385 3300037418 Bacteria 1698
25 Ga0395905_0000211 3300037471 Bacteria 89842
26 Ga0439436_0001130 3300041404 Bacteria 7562
27 Ga0439439_0000570 3300041406 Bacteria 6427
28 Ga0439449_0000055 3300042007 Bacteria 34359
29 Ga0439457_008600 3300042014 Bacteria 2403
30 Ga0439462_0005732 3300042015 Bacteria 3070
31 Ga0495654_0069655 3300046530 Bacteria 1670
32 Ga0496110_0000539 3300048913 Bacteria 25812
33 Ga0496116_0093443 3300048919 Bacteria 1821
34 Ga0496117_0010657 3300048920 Bacteria 8333
35 Ga0496121_0024461 3300048924 Bacteria 5773
36 Ga0496123_0055274 3300048926 Bacteria 2606
37 Ga0496125_0000431 3300048928 Bacteria 77252
38 Ga0496125_0000531 3300048928 Bacteria 65633
39 Ga0496125_0007536 3300048928 Bacteria 11562
40 Ga0496126_0038377 3300048929 Bacteria 4458
41 Ga0501034_0106369 3300049571 Bacteria 2799
42 Ga0501035_0162312 3300049822 Bacteria 1934
43 nmdc:mga06z11_92707_c1 3300050494 Bacteria 1643
44 Ga0495601_0111438 3300053077 Bacteria 1772
45 Ga0495595_0062057 3300053084 Bacteria 1752
46 Ga0495619_0122521 3300053085 Bacteria 1783
47 8057739075 8057733483 Bacteria 6578323
48 2512637980 2512564013 Bacteria 6286191
49 2556064516 2554235469 Bacteria 3590176
50 2563928248 2563366752 Bacteria 4961801
51 2573040273 2571042588 Bacteria 5045676
52 2580934725 2579778775 Bacteria 5360914
53 2587738333 2585428059 Bacteria 8696589
54 2621277314 2619619294 Bacteria 5575484
55 2643891488 2643221576 Bacteria 5214352
56 2643960536 2643221590 Bacteria 5214697
57 2644036108 2643221604 Bacteria 5014917
58 2644102113 2643221617 Bacteria 5139111
59 2644115336 2643221620 Bacteria 5134593
60 2672337875 2671180330 Bacteria 5521719
61 2673821227 2671180694 Bacteria 7506943
62 2688069952 2687453257 Bacteria 6784659
63 2723602251 2721755693 Bacteria 6126117
64 2730138387 2728369359 Bacteria 5621728
65 2738815930 2738541295 Bacteria 5730091
66 2739234326 2738543010 Bacteria 5583595
67 2745165889 2744054657 Bacteria 5016802
68 2753809120 2751185905 Bacteria 6142767
69 2802439517 2802428803 Bacteria 5806948
70 2816861728 2816332186 Bacteria 5331395
71 2817618507 2816332336 Bacteria 5207640
72 2819568484 2818991441 Bacteria 5062707
73 2842687011 2842682962 Bacteria 5589973
74 2842885131 2842882022 Bacteria 6158489
75 2852675176 2852673933 Bacteria 3347676
76 2857463602 2857460504 Bacteria 5194327
77 2857475661 2857472729 Bacteria 6568124
78 2857585152 2857581216 Bacteria 5522813
79 2857607851 2857604169 Bacteria 5111450
80 2865001267 2864997549 Bacteria 5139696
81 2881637580 2881636855 Bacteria 5205297
82 2889278335 2889276214 Bacteria 5979355
83 2889298817 2889295896 Bacteria 4704906
84 2904527569 2904524088 Bacteria 5887454
85 2904600122 2904595352 Bacteria 6124848
86 2919143786 2919143609 Bacteria 6219228
87 2919426880 2919425241 Bacteria 8055701
88 2919520678 2919517244 Bacteria 5858162
89 2925329705 2925326138 Bacteria 9652120
90 2928097367 2928093941 Bacteria 5965005
91 2929186576 2929183550 Bacteria 6377511
92 2929212203 2929206907 Bacteria 5918291
93 2939595237 2939593269 Bacteria 4798695
94 2956900360 2956897341 Bacteria 5447711
95 2964376806 2964375228 Bacteria 4909004
96 2980126306 2980125574 Bacteria 5567337
97 2981288143 2981284811 Bacteria 4641497
98 2981292965 2981289755 Bacteria 4641509
99 2981983891 2981980479 Bacteria 4641628
100 2981988813 2981985349 Bacteria 4641497
101 2996706927 2996706504 Bacteria 5757485
102 3001275451 3001272096 Bacteria 4729684
103 648168776 648028048 Bacteria 5394884
104 8015557797 8015556637 Bacteria 3582323
105 8022893693 8022893055 Bacteria 5300455
106 8057476640 8057473075 Bacteria 5892720
107 8057636881 8057632132 Bacteria 4726859
108 JGI25151J46595_10002081
109 JGI25151J46595_10007011
110 Ga0055532_1001233
111 Ga0075367_10004869
112 Ga0079104_1000067
113 Ga0079104_1002190
114 Ga0079104_1018477
115 Ga0105244_10013150
116 Ga0105250_10001391
117 Ga0157374_10003288
118 Ga0209147_100069
119 Ga0209147_100516
120 Ga0209130_1001947
121 Ga0209025_1000043
122 Ga0209025_1000863
123 Ga0209025_1016976
124 Ga0207696_1007837
125 Ga0209281_1000150
126 Ga0209281_1000470
127 Ga0209281_1001472
128 Ga0268266_10000673
129 Ga0316574_0062106
130 Ga0316582_0136385
131 Ga0395900_0269385
132 Ga0395905_0000211
133 Ga0439436_0001130
134 Ga0439439_0000570
135 Ga0439449_0000055
136 Ga0439457_008600
137 Ga0439462_0005732
138 Ga0495654_0069655
139 Ga0496110_0000539
140 Ga0496116_0093443
141 Ga0496117_0010657
142 Ga0496121_0024461
143 Ga0496123_0055274
144 Ga0496125_0000431
145 Ga0496125_0000531
146 Ga0496125_0007536
147 Ga0496126_0038377
148 Ga0501034_0106369
149 Ga0501035_0162312
150 nmdc:mga06z11_92707_c1
151 Ga0495601_0111438
152 Ga0495595_0062057
153 Ga0495619_0122521
154 8057739075
155 2512637980
156 2556064516
157 2563928248
158 2573040273
159 2580934725
160 2587738333
161 2621277314
162 2643891488
163 2643960536
164 2644036108
165 2644102113
166 2644115336
167 2672337875
168 2673821227
169 2688069952
170 2723602251
171 2730138387
172 2738815930
173 2739234326
174 2745165889
175 2753809120
176 2802439517
177 2816861728
178 2817618507
179 2819568484
180 2842687011
181 2842885131
182 2852675176
183 2857463602
184 2857475661
185 2857585152
186 2857607851
187 2865001267
188 2881637580
189 2889278335
190 2889298817
191 2904527569
192 2904600122
193 2919143786
194 2919426880
195 2919520678
196 2925329705
197 2928097367
198 2929186576
199 2929212203
200 2939595237
201 2956900360
202 2964376806
203 2980126306
204 2981288143
205 2981292965
206 2981983891
207 2981988813
208 2996706927
209 3001275451
210 648168776
211 8015557797
212 8022893693
213 8057476640
214 8057636881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02696

SelO

Protein adenylyltransferase SelO

61

514

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iny-assembly1.cif.gz_A crystal structure of an uncharacterized protein 0.9434 11 476
6iny-assembly1.cif.gz_A crystal structure of an uncharacterized protein 0.9414 11 476
6eac-assembly4.cif.gz_D pseudomonas syringae selo 0.9355 12 474
6k20-assembly1.cif.gz_A structure of apo ydiu 0.9309 11 476
6k20-assembly1.cif.gz_A structure of apo ydiu 0.929 11 476
ID Description Score Start End Superfamily
af_A0A5K1K8V9_426_661_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4556 98 250 1.10.510.10
af_Q8GW96_373_447_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3958 339 404 1.10.10.630
af_Q8BHM9_56_165_3.30.70.960 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SEA domain 0.3824 141 212 3.30.70.960
af_Q8GW96_373_447_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3608 339 404 1.10.10.630
af_A4I3S8_8_332_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.3552 98 413 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A7W0DAF1-F1-model_v4 Protein adenylyltransferase SelO (EC 2.7.7.108) 0.9817 8 487 GO:0000287
GO:0005524
GO:0016779
AF-A0A6I1PA93-F1-model_v4 deleted 0.9815 71 237
AF-A0A645BJE8-F1-model_v4 Protein adenylyltransferase SelO 0.9809 51 487 GO:0005524
GO:0016779
GO:0046872
AF-A0A353LXC6-F1-model_v4 Selenoprotein O 0.9805 46 178 GO:0005524
GO:0046872
GO:0070733
AF-A0A847Z6C6-F1-model_v4 Protein adenylyltransferase SelO (EC 2.7.7.108) 0.979 4 487 GO:0000287
GO:0005524
GO:0016779

Map