F046089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 107 | 97 | 214 | 488 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8057733483|8057739075 |
| Length | 543 |
| Sequence | SLQAQLDAPPAFFEEYQFSSCSHLWWKRYNNFAEVNPKSTSDTKRQKEKGDMMTEKKAIIETGWNFDNSYACLPKSFFTRLNPTPVPSPKLIILNDALAVSLGLDVQAVQSSTGVAVLAGNQIPEGALPLAQAYAGHQFGHFTMLGDGRAILLGEQITPLGERVDIQLKGSGKTPYSRRGDGLAALGPMLREYIISEAMHALGIATTRSLAVVTTGETVIRETEQPGAILTRVAASHLRVGTFQYVSNWGTAQDLRALADYTLQRHFPEVADEENRYLFLLQEVIKRQAVLIAKWQLVGFIHGVMNTDNMALSGETIDYGPCAFMDAYDPATVFSSIDIHGRYAYGNQPHIAAWNLARFAETLLPLLHDNEVQAVQLAEDAISDFSELYHRKWLAGMRAKLGIFNEELQDESLIEDLLGMMQKYRADYTNTFRELTFDKVEDTALFGTTEFAQWHELWQARLVRQQESKASSHQLMRNSNPAIIPRNHRVEDALEAAVEQGDYSVMERLLDVLSSPYAHSPEQADYSTLPALSTRPYRTFCGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 3 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 4 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 5 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 6 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 7 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 8 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 9 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 10 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 11 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 12 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 13 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 15 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 16 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 17 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 18 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 19 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 20 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 21 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 22 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 23 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 24 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 25 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 26 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 27 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 28 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 29 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 30 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 31 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 32 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 33 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 34 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 35 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 37 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 38 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 39 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 40 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 41 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 42 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 43 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 44 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 45 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 46 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 47 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 48 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 49 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 50 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 51 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 52 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 53 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 54 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 55 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 56 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 57 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 58 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 59 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 60 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 61 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 62 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 63 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 64 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 65 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 66 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 67 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 68 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 69 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 70 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 71 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 72 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 73 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 74 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 75 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 76 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 77 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 78 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 79 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 80 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 81 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 82 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 83 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 84 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 85 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 86 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 87 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 88 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 89 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 90 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 91 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 92 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 93 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 94 | 8015556637 | Bdellovibrio reynosensis LBG001 | Isolate | Rhizosphere |
| 95 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 96 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 97 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 42.99 |
| Metatranscriptomes | 0 |
| Isolates | 57.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.28 |
| Nodule | 5.61 |
| Rhizoplane | 0.93 |
| Rhizosphere | 45.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10002081 | 3300003187 | Bacteria | 12469 |
| 2 | JGI25151J46595_10007011 | 3300003187 | Bacteria | 5578 |
| 3 | Ga0055532_1001233 | 3300003758 | Bacteria | 7553 |
| 4 | Ga0075367_10004869 | 3300006178 | Bacteria | 6611 |
| 5 | Ga0079104_1000067 | 3300006946 | Bacteria | 155559 |
| 6 | Ga0079104_1002190 | 3300006946 | Bacteria | 11014 |
| 7 | Ga0079104_1018477 | 3300006946 | Bacteria | 1973 |
| 8 | Ga0105244_10013150 | 3300009036 | Bacteria | 4849 |
| 9 | Ga0105250_10001391 | 3300009092 | Bacteria | 13081 |
| 10 | Ga0157374_10003288 | 3300013296 | Bacteria | 13579 |
| 11 | Ga0209147_100069 | 3300025229 | Bacteria | 224017 |
| 12 | Ga0209147_100516 | 3300025229 | Bacteria | 22397 |
| 13 | Ga0209130_1001947 | 3300025284 | Bacteria | 11462 |
| 14 | Ga0209025_1000043 | 3300025294 | Bacteria | 350458 |
| 15 | Ga0209025_1000863 | 3300025294 | Bacteria | 47880 |
| 16 | Ga0209025_1016976 | 3300025294 | Bacteria | 4242 |
| 17 | Ga0207696_1007837 | 3300025711 | Bacteria | 4140 |
| 18 | Ga0209281_1000150 | 3300027111 | Bacteria | 167280 |
| 19 | Ga0209281_1000470 | 3300027111 | Bacteria | 56678 |
| 20 | Ga0209281_1001472 | 3300027111 | Bacteria | 13674 |
| 21 | Ga0268266_10000673 | 3300028379 | Bacteria | 46152 |
| 22 | Ga0316574_0062106 | 3300035398 | Bacteria | 2347 |
| 23 | Ga0316582_0136385 | 3300036647 | Bacteria | 1652 |
| 24 | Ga0395900_0269385 | 3300037418 | Bacteria | 1698 |
| 25 | Ga0395905_0000211 | 3300037471 | Bacteria | 89842 |
| 26 | Ga0439436_0001130 | 3300041404 | Bacteria | 7562 |
| 27 | Ga0439439_0000570 | 3300041406 | Bacteria | 6427 |
| 28 | Ga0439449_0000055 | 3300042007 | Bacteria | 34359 |
| 29 | Ga0439457_008600 | 3300042014 | Bacteria | 2403 |
| 30 | Ga0439462_0005732 | 3300042015 | Bacteria | 3070 |
| 31 | Ga0495654_0069655 | 3300046530 | Bacteria | 1670 |
| 32 | Ga0496110_0000539 | 3300048913 | Bacteria | 25812 |
| 33 | Ga0496116_0093443 | 3300048919 | Bacteria | 1821 |
| 34 | Ga0496117_0010657 | 3300048920 | Bacteria | 8333 |
| 35 | Ga0496121_0024461 | 3300048924 | Bacteria | 5773 |
| 36 | Ga0496123_0055274 | 3300048926 | Bacteria | 2606 |
| 37 | Ga0496125_0000431 | 3300048928 | Bacteria | 77252 |
| 38 | Ga0496125_0000531 | 3300048928 | Bacteria | 65633 |
| 39 | Ga0496125_0007536 | 3300048928 | Bacteria | 11562 |
| 40 | Ga0496126_0038377 | 3300048929 | Bacteria | 4458 |
| 41 | Ga0501034_0106369 | 3300049571 | Bacteria | 2799 |
| 42 | Ga0501035_0162312 | 3300049822 | Bacteria | 1934 |
| 43 | nmdc:mga06z11_92707_c1 | 3300050494 | Bacteria | 1643 |
| 44 | Ga0495601_0111438 | 3300053077 | Bacteria | 1772 |
| 45 | Ga0495595_0062057 | 3300053084 | Bacteria | 1752 |
| 46 | Ga0495619_0122521 | 3300053085 | Bacteria | 1783 |
| 47 | 8057739075 | 8057733483 | Bacteria | 6578323 |
| 48 | 2512637980 | 2512564013 | Bacteria | 6286191 |
| 49 | 2556064516 | 2554235469 | Bacteria | 3590176 |
| 50 | 2563928248 | 2563366752 | Bacteria | 4961801 |
| 51 | 2573040273 | 2571042588 | Bacteria | 5045676 |
| 52 | 2580934725 | 2579778775 | Bacteria | 5360914 |
| 53 | 2587738333 | 2585428059 | Bacteria | 8696589 |
| 54 | 2621277314 | 2619619294 | Bacteria | 5575484 |
| 55 | 2643891488 | 2643221576 | Bacteria | 5214352 |
| 56 | 2643960536 | 2643221590 | Bacteria | 5214697 |
| 57 | 2644036108 | 2643221604 | Bacteria | 5014917 |
| 58 | 2644102113 | 2643221617 | Bacteria | 5139111 |
| 59 | 2644115336 | 2643221620 | Bacteria | 5134593 |
| 60 | 2672337875 | 2671180330 | Bacteria | 5521719 |
| 61 | 2673821227 | 2671180694 | Bacteria | 7506943 |
| 62 | 2688069952 | 2687453257 | Bacteria | 6784659 |
| 63 | 2723602251 | 2721755693 | Bacteria | 6126117 |
| 64 | 2730138387 | 2728369359 | Bacteria | 5621728 |
| 65 | 2738815930 | 2738541295 | Bacteria | 5730091 |
| 66 | 2739234326 | 2738543010 | Bacteria | 5583595 |
| 67 | 2745165889 | 2744054657 | Bacteria | 5016802 |
| 68 | 2753809120 | 2751185905 | Bacteria | 6142767 |
| 69 | 2802439517 | 2802428803 | Bacteria | 5806948 |
| 70 | 2816861728 | 2816332186 | Bacteria | 5331395 |
| 71 | 2817618507 | 2816332336 | Bacteria | 5207640 |
| 72 | 2819568484 | 2818991441 | Bacteria | 5062707 |
| 73 | 2842687011 | 2842682962 | Bacteria | 5589973 |
| 74 | 2842885131 | 2842882022 | Bacteria | 6158489 |
| 75 | 2852675176 | 2852673933 | Bacteria | 3347676 |
| 76 | 2857463602 | 2857460504 | Bacteria | 5194327 |
| 77 | 2857475661 | 2857472729 | Bacteria | 6568124 |
| 78 | 2857585152 | 2857581216 | Bacteria | 5522813 |
| 79 | 2857607851 | 2857604169 | Bacteria | 5111450 |
| 80 | 2865001267 | 2864997549 | Bacteria | 5139696 |
| 81 | 2881637580 | 2881636855 | Bacteria | 5205297 |
| 82 | 2889278335 | 2889276214 | Bacteria | 5979355 |
| 83 | 2889298817 | 2889295896 | Bacteria | 4704906 |
| 84 | 2904527569 | 2904524088 | Bacteria | 5887454 |
| 85 | 2904600122 | 2904595352 | Bacteria | 6124848 |
| 86 | 2919143786 | 2919143609 | Bacteria | 6219228 |
| 87 | 2919426880 | 2919425241 | Bacteria | 8055701 |
| 88 | 2919520678 | 2919517244 | Bacteria | 5858162 |
| 89 | 2925329705 | 2925326138 | Bacteria | 9652120 |
| 90 | 2928097367 | 2928093941 | Bacteria | 5965005 |
| 91 | 2929186576 | 2929183550 | Bacteria | 6377511 |
| 92 | 2929212203 | 2929206907 | Bacteria | 5918291 |
| 93 | 2939595237 | 2939593269 | Bacteria | 4798695 |
| 94 | 2956900360 | 2956897341 | Bacteria | 5447711 |
| 95 | 2964376806 | 2964375228 | Bacteria | 4909004 |
| 96 | 2980126306 | 2980125574 | Bacteria | 5567337 |
| 97 | 2981288143 | 2981284811 | Bacteria | 4641497 |
| 98 | 2981292965 | 2981289755 | Bacteria | 4641509 |
| 99 | 2981983891 | 2981980479 | Bacteria | 4641628 |
| 100 | 2981988813 | 2981985349 | Bacteria | 4641497 |
| 101 | 2996706927 | 2996706504 | Bacteria | 5757485 |
| 102 | 3001275451 | 3001272096 | Bacteria | 4729684 |
| 103 | 648168776 | 648028048 | Bacteria | 5394884 |
| 104 | 8015557797 | 8015556637 | Bacteria | 3582323 |
| 105 | 8022893693 | 8022893055 | Bacteria | 5300455 |
| 106 | 8057476640 | 8057473075 | Bacteria | 5892720 |
| 107 | 8057636881 | 8057632132 | Bacteria | 4726859 |
| 108 | JGI25151J46595_10002081 | |||
| 109 | JGI25151J46595_10007011 | |||
| 110 | Ga0055532_1001233 | |||
| 111 | Ga0075367_10004869 | |||
| 112 | Ga0079104_1000067 | |||
| 113 | Ga0079104_1002190 | |||
| 114 | Ga0079104_1018477 | |||
| 115 | Ga0105244_10013150 | |||
| 116 | Ga0105250_10001391 | |||
| 117 | Ga0157374_10003288 | |||
| 118 | Ga0209147_100069 | |||
| 119 | Ga0209147_100516 | |||
| 120 | Ga0209130_1001947 | |||
| 121 | Ga0209025_1000043 | |||
| 122 | Ga0209025_1000863 | |||
| 123 | Ga0209025_1016976 | |||
| 124 | Ga0207696_1007837 | |||
| 125 | Ga0209281_1000150 | |||
| 126 | Ga0209281_1000470 | |||
| 127 | Ga0209281_1001472 | |||
| 128 | Ga0268266_10000673 | |||
| 129 | Ga0316574_0062106 | |||
| 130 | Ga0316582_0136385 | |||
| 131 | Ga0395900_0269385 | |||
| 132 | Ga0395905_0000211 | |||
| 133 | Ga0439436_0001130 | |||
| 134 | Ga0439439_0000570 | |||
| 135 | Ga0439449_0000055 | |||
| 136 | Ga0439457_008600 | |||
| 137 | Ga0439462_0005732 | |||
| 138 | Ga0495654_0069655 | |||
| 139 | Ga0496110_0000539 | |||
| 140 | Ga0496116_0093443 | |||
| 141 | Ga0496117_0010657 | |||
| 142 | Ga0496121_0024461 | |||
| 143 | Ga0496123_0055274 | |||
| 144 | Ga0496125_0000431 | |||
| 145 | Ga0496125_0000531 | |||
| 146 | Ga0496125_0007536 | |||
| 147 | Ga0496126_0038377 | |||
| 148 | Ga0501034_0106369 | |||
| 149 | Ga0501035_0162312 | |||
| 150 | nmdc:mga06z11_92707_c1 | |||
| 151 | Ga0495601_0111438 | |||
| 152 | Ga0495595_0062057 | |||
| 153 | Ga0495619_0122521 | |||
| 154 | 8057739075 | |||
| 155 | 2512637980 | |||
| 156 | 2556064516 | |||
| 157 | 2563928248 | |||
| 158 | 2573040273 | |||
| 159 | 2580934725 | |||
| 160 | 2587738333 | |||
| 161 | 2621277314 | |||
| 162 | 2643891488 | |||
| 163 | 2643960536 | |||
| 164 | 2644036108 | |||
| 165 | 2644102113 | |||
| 166 | 2644115336 | |||
| 167 | 2672337875 | |||
| 168 | 2673821227 | |||
| 169 | 2688069952 | |||
| 170 | 2723602251 | |||
| 171 | 2730138387 | |||
| 172 | 2738815930 | |||
| 173 | 2739234326 | |||
| 174 | 2745165889 | |||
| 175 | 2753809120 | |||
| 176 | 2802439517 | |||
| 177 | 2816861728 | |||
| 178 | 2817618507 | |||
| 179 | 2819568484 | |||
| 180 | 2842687011 | |||
| 181 | 2842885131 | |||
| 182 | 2852675176 | |||
| 183 | 2857463602 | |||
| 184 | 2857475661 | |||
| 185 | 2857585152 | |||
| 186 | 2857607851 | |||
| 187 | 2865001267 | |||
| 188 | 2881637580 | |||
| 189 | 2889278335 | |||
| 190 | 2889298817 | |||
| 191 | 2904527569 | |||
| 192 | 2904600122 | |||
| 193 | 2919143786 | |||
| 194 | 2919426880 | |||
| 195 | 2919520678 | |||
| 196 | 2925329705 | |||
| 197 | 2928097367 | |||
| 198 | 2929186576 | |||
| 199 | 2929212203 | |||
| 200 | 2939595237 | |||
| 201 | 2956900360 | |||
| 202 | 2964376806 | |||
| 203 | 2980126306 | |||
| 204 | 2981288143 | |||
| 205 | 2981292965 | |||
| 206 | 2981983891 | |||
| 207 | 2981988813 | |||
| 208 | 2996706927 | |||
| 209 | 3001275451 | |||
| 210 | 648168776 | |||
| 211 | 8015557797 | |||
| 212 | 8022893693 | |||
| 213 | 8057476640 | |||
| 214 | 8057636881 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iny-assembly1.cif.gz_A | crystal structure of an uncharacterized protein | 0.9434 | 11 | 476 |
| 6iny-assembly1.cif.gz_A | crystal structure of an uncharacterized protein | 0.9414 | 11 | 476 |
| 6eac-assembly4.cif.gz_D | pseudomonas syringae selo | 0.9355 | 12 | 474 |
| 6k20-assembly1.cif.gz_A | structure of apo ydiu | 0.9309 | 11 | 476 |
| 6k20-assembly1.cif.gz_A | structure of apo ydiu | 0.929 | 11 | 476 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A5K1K8V9_426_661_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.4556 | 98 | 250 | 1.10.510.10 |
| af_Q8GW96_373_447_1.10.10.630 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like | 0.3958 | 339 | 404 | 1.10.10.630 |
| af_Q8BHM9_56_165_3.30.70.960 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SEA domain | 0.3824 | 141 | 212 | 3.30.70.960 |
| af_Q8GW96_373_447_1.10.10.630 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like | 0.3608 | 339 | 404 | 1.10.10.630 |
| af_A4I3S8_8_332_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.3552 | 98 | 413 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0DAF1-F1-model_v4 | Protein adenylyltransferase SelO (EC 2.7.7.108) | 0.9817 | 8 | 487 |
GO:0000287
GO:0005524 GO:0016779 |
| AF-A0A6I1PA93-F1-model_v4 | deleted | 0.9815 | 71 | 237 |
|
| AF-A0A645BJE8-F1-model_v4 | Protein adenylyltransferase SelO | 0.9809 | 51 | 487 |
GO:0005524
GO:0016779 GO:0046872 |
| AF-A0A353LXC6-F1-model_v4 | Selenoprotein O | 0.9805 | 46 | 178 |
GO:0005524
GO:0046872 GO:0070733 |
| AF-A0A847Z6C6-F1-model_v4 | Protein adenylyltransferase SelO (EC 2.7.7.108) | 0.979 | 4 | 487 |
GO:0000287
GO:0005524 GO:0016779 |