F048453

General Info

Members Datasets Scaffolds Average Seq Length
108 87 216 134

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10378878|Ga0111539_103788782
Length 159
Sequence MRQSIRSLGKRSRTLNVLHPSMSDSAPRLLYCHCQYAQVVPKDVKEVVLRRLCESGVAFEAVADLCEMAARRDPALQRLAACGGLKIAACFPRAVKGLFHQANADLPSDAAEVLNMRVQSADDVCAALLSSELKPNLPARPTVQPLDQRMDAANQISAG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.63
Nodule 0
Rhizoplane 0.93
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 44.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10378878 3300009094 Unclassified 1647
2 Ga0055530_10015329 3300003791 Unclassified 2508
3 Ga0070658_10014373 3300005327 Bacteria 6351
4 Ga0068869_100837937 3300005334 Unclassified 793
5 Ga0070666_11012524 3300005335 Bacteria 616
6 Ga0070660_100148917 3300005339 Unclassified 1881
7 Ga0070668_100534025 3300005347 Bacteria 1019
8 Ga0070701_10428198 3300005438 Unclassified 844
9 Ga0070701_10717488 3300005438 Unclassified 674
10 Ga0070694_100259605 3300005444 Bacteria 1317
11 Ga0070708_101214740 3300005445 Bacteria 705
12 Ga0070662_101841979 3300005457 Unclassified 523
13 Ga0070685_10793559 3300005466 Unclassified 697
14 Ga0070679_100490418 3300005530 Unclassified 1173
15 Ga0070684_100646900 3300005535 Unclassified 984
16 Ga0068853_100000060 3300005539 Bacteria 78205
17 Ga0070686_100036744 3300005544 Bacteria 3035
18 Ga0070665_100443193 3300005548 Bacteria 1308
19 Ga0068855_100442140 3300005563 Bacteria 1420
20 Ga0068852_100015746 3300005616 Bacteria 5878
21 Ga0068859_100473083 3300005617 Bacteria 1349
22 Ga0068859_100796293 3300005617 Bacteria 1033
23 Ga0068859_101039077 3300005617 Bacteria 900
24 Ga0068859_102780977 3300005617 Unclassified 537
25 Ga0068864_102711087 3300005618 Unclassified 501
26 Ga0068851_10186611 3300005834 Bacteria 1151
27 Ga0068863_100502080 3300005841 Unclassified 1195
28 Ga0068858_100036273 3300005842 Bacteria 4572
29 Ga0068858_100049523 3300005842 Bacteria 3891
30 Ga0068858_100644745 3300005842 Bacteria 1029
31 Ga0068860_101088683 3300005843 Bacteria 818
32 Ga0068860_101701071 3300005843 Unclassified 653
33 Ga0068862_101992790 3300005844 Unclassified 591
34 Ga0075433_10300234 3300006852 Bacteria 1422
35 Ga0075434_102262103 3300006871 Unclassified 547
36 Ga0097620_100473066 3300006931 Bacteria 1349
37 Ga0097620_100796302 3300006931 Bacteria 1033
38 Ga0097620_101038957 3300006931 Bacteria 900
39 Ga0097620_102780234 3300006931 Unclassified 537
40 Ga0075435_100543640 3300007076 Bacteria 1006
41 Ga0105240_10014835 3300009093 Bacteria 10621
42 Ga0111539_10171957 3300009094 Unclassified 2531
43 Ga0105237_10002055 3300009545 Bacteria 25558
44 Ga0105238_11085267 3300009551 Bacteria 823
45 Ga0105238_12927749 3300009551 Unclassified 513
46 Ga0105249_10724981 3300009553 Bacteria 1055
47 Ga0105249_11078362 3300009553 Bacteria 873
48 Ga0099796_10146458 3300010159 Unclassified 927
49 Ga0105239_10056573 3300010375 Bacteria 4302
50 Ga0105239_10255611 3300010375 Archaea 1968
51 Ga0105239_10453510 3300010375 Bacteria 1455
52 Ga0157371_10977855 3300013102 Unclassified 645
53 Ga0157370_10755176 3300013104 Bacteria 886
54 Ga0157374_10539265 3300013296 Bacteria 1174
55 Ga0163162_10764151 3300013306 Bacteria 1085
56 Ga0157375_11340313 3300013308 Bacteria 842
57 Ga0163163_10023280 3300014325 Bacteria 5876
58 Ga0157380_11619344 3300014326 Bacteria 703
59 Ga0209050_1002359 3300025298 Bacteria 16471
60 Ga0207680_10931315 3300025903 Bacteria 623
61 Ga0207705_10055036 3300025909 Bacteria 2868
62 Ga0207695_10000270 3300025913 Bacteria 130172
63 Ga0207695_10078160 3300025913 Bacteria 3358
64 Ga0207657_10422444 3300025919 Bacteria 1048
65 Ga0207652_10865817 3300025921 Unclassified 800
66 Ga0207644_10081404 3300025931 Unclassified 2393
67 Ga0207667_10001093 3300025949 Bacteria 34363
68 Ga0207667_10382932 3300025949 Bacteria 1433
69 Ga0207668_10352055 3300025972 Bacteria 1232
70 Ga0207703_10012350 3300026035 Bacteria 6658
71 Ga0207703_10032117 3300026035 Bacteria 4155
72 Ga0207639_10000087 3300026041 Bacteria 79236
73 Ga0207676_10035929 3300026095 Bacteria 3766
74 Ga0207698_10055094 3300026142 Unclassified 3062
75 Ga0268266_10417545 3300028379 Bacteria 1271
76 Ga0268264_11399893 3300028381 Unclassified 710
77 Ga0265338_10170885 3300028800 Bacteria 1667
78 Ga0265332_10013487 3300031238 Unclassified 3622
79 Ga0265328_10055972 3300031239 Unclassified 1447
80 Ga0265329_10001171 3300031242 Bacteria 12896
81 Ga0265327_10326119 3300031251 Unclassified 673
82 Ga0265316_10088512 3300031344 Unclassified 2364
83 Ga0265314_10000792 3300031711 Bacteria 37540
84 Ga0307405_10424464 3300031731 Unclassified 1047
85 Ga0307410_10198239 3300031852 Unclassified 1531
86 Ga0307406_10661745 3300031901 Unclassified 868
87 Ga0307412_10033007 3300031911 Bacteria 3286
88 Ga0307409_100041202 3300031995 Unclassified 3447
89 Ga0307416_100730959 3300032002 Bacteria 1081
90 Ga0307411_10479559 3300032005 Unclassified 1047
91 Ga0373927_0995639 3300035695 Unclassified 553
92 Ga0451793_1294167 3300041452 Unclassified 639
93 Ga0451576_1226384 3300045051 Unclassified 783
94 Ga0451576_1310279 3300045051 Bacteria 755
95 Ga0451576_2115560 3300045051 Unclassified 579
96 Ga0495580_0921169 3300046472 Unclassified 561
97 Ga0495643_0000111 3300046522 Bacteria 135372
98 Ga0495625_0802918 3300046660 Unclassified 547
99 Ga0495635_0899755 3300046663 Unclassified 567
100 Ga0495658_0025147 3300046683 Unclassified 3180
101 Ga0495684_0440206 3300047471 Unclassified 908
102 Ga0501044_1373178 3300049823 Unclassified 572
103 nmdc:mga07m45_157832_c1 3300050496 Unclassified 1316
104 nmdc:mga09592_1594551_c1 3300050508 Unclassified 529
105 nmdc:mga08y16_389349_c1 3300050511 Unclassified 1428
106 nmdc:mga08y16_5226_c1 3300050511 Bacteria 13559
107 Ga0500568_0288254 3300053139 Unclassified 596
108 Ga0500616_0004356 3300053153 Bacteria 10128
109 Ga0111539_10378878
110 Ga0055530_10015329
111 Ga0070658_10014373
112 Ga0068869_100837937
113 Ga0070666_11012524
114 Ga0070660_100148917
115 Ga0070668_100534025
116 Ga0070701_10428198
117 Ga0070701_10717488
118 Ga0070694_100259605
119 Ga0070708_101214740
120 Ga0070662_101841979
121 Ga0070685_10793559
122 Ga0070679_100490418
123 Ga0070684_100646900
124 Ga0068853_100000060
125 Ga0070686_100036744
126 Ga0070665_100443193
127 Ga0068855_100442140
128 Ga0068852_100015746
129 Ga0068859_100473083
130 Ga0068859_100796293
131 Ga0068859_101039077
132 Ga0068859_102780977
133 Ga0068864_102711087
134 Ga0068851_10186611
135 Ga0068863_100502080
136 Ga0068858_100036273
137 Ga0068858_100049523
138 Ga0068858_100644745
139 Ga0068860_101088683
140 Ga0068860_101701071
141 Ga0068862_101992790
142 Ga0075433_10300234
143 Ga0075434_102262103
144 Ga0097620_100473066
145 Ga0097620_100796302
146 Ga0097620_101038957
147 Ga0097620_102780234
148 Ga0075435_100543640
149 Ga0105240_10014835
150 Ga0111539_10171957
151 Ga0105237_10002055
152 Ga0105238_11085267
153 Ga0105238_12927749
154 Ga0105249_10724981
155 Ga0105249_11078362
156 Ga0099796_10146458
157 Ga0105239_10056573
158 Ga0105239_10255611
159 Ga0105239_10453510
160 Ga0157371_10977855
161 Ga0157370_10755176
162 Ga0157374_10539265
163 Ga0163162_10764151
164 Ga0157375_11340313
165 Ga0163163_10023280
166 Ga0157380_11619344
167 Ga0209050_1002359
168 Ga0207680_10931315
169 Ga0207705_10055036
170 Ga0207695_10000270
171 Ga0207695_10078160
172 Ga0207657_10422444
173 Ga0207652_10865817
174 Ga0207644_10081404
175 Ga0207667_10001093
176 Ga0207667_10382932
177 Ga0207668_10352055
178 Ga0207703_10012350
179 Ga0207703_10032117
180 Ga0207639_10000087
181 Ga0207676_10035929
182 Ga0207698_10055094
183 Ga0268266_10417545
184 Ga0268264_11399893
185 Ga0265338_10170885
186 Ga0265332_10013487
187 Ga0265328_10055972
188 Ga0265329_10001171
189 Ga0265327_10326119
190 Ga0265316_10088512
191 Ga0265314_10000792
192 Ga0307405_10424464
193 Ga0307410_10198239
194 Ga0307406_10661745
195 Ga0307412_10033007
196 Ga0307409_100041202
197 Ga0307416_100730959
198 Ga0307411_10479559
199 Ga0373927_0995639
200 Ga0451793_1294167
201 Ga0451576_1226384
202 Ga0451576_1310279
203 Ga0451576_2115560
204 Ga0495580_0921169
205 Ga0495643_0000111
206 Ga0495625_0802918
207 Ga0495635_0899755
208 Ga0495658_0025147
209 Ga0495684_0440206
210 Ga0501044_1373178
211 nmdc:mga07m45_157832_c1
212 nmdc:mga09592_1594551_c1
213 nmdc:mga08y16_389349_c1
214 nmdc:mga08y16_5226_c1
215 Ga0500568_0288254
216 Ga0500616_0004356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wpg-assembly1.cif.gz_A group a streptococcus gaca is an essential dtdp-4-dehydrorhamnose reductase (rmld) 0.6519 3 69
5c53-assembly1.cif.gz_B probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma 0.624 6 42
5c52-assembly1.cif.gz_B probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma 0.6232 6 42
4rkr-assembly2.cif.gz_C crystal structure of laci family transcriptional regulator from arthrobacter sp. fb24, target efi-560007, complex with lactose 0.5781 4 94
3h5w-assembly1.cif.gz_B crystal structure of the glur2-atd in space group p212121 without solvent 0.5603 4 86
ID Description Score Start End Superfamily
4wpgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5803 3 79 3.40.50.720
3trhI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5537 7 92 3.40.50.1970
af_A4I570_4_148_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.5532 6 118 3.40.50.10330
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.5487 6 68 3.40.718.10
2lv8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5475 5 107 3.40.50.11230
ID Description Score Start End GO Terms
AF-A0A6L7UAQ8-F1-model_v4 deleted 0.9896 5 108
AF-A0A2V8DM40-F1-model_v4 Uncharacterized protein 0.9841 5 107
AF-A0A2E1W3X3-F1-model_v4 Uncharacterized protein 0.982 7 109
AF-A0A258AN02-F1-model_v4 Uncharacterized protein 0.98 5 112
AF-A0A3D3NXH6-F1-model_v4 Uncharacterized protein 0.9798 3 108

Map