F064073

General Info

Members Datasets Scaffolds Average Seq Length
111 91 222 138

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000019|Ga0157371_1000001984
Length 135
Sequence MLRYFCVLLGVLGLVAIRGVEDHFFYDPFLNFFKTANHSAIFPNFSWGKLILNYLMRFGLNTFFSLVIIHFLFQNKEWTKQALILIVFPIYLFCIYDRFQFGYLFSFYVRRFVIQPLTVILIIPIFYYRKKLIQN

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
15 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
20 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
21 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
22 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
25 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
26 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
27 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
28 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
29 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
30 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
31 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
32 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
33 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
34 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
35 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
36 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
37 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
38 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
39 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
40 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
41 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
42 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
43 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
44 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
45 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
46 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
47 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
48 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
49 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
50 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
51 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
52 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
53 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
54 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
55 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
56 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
57 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
58 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
59 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
60 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
61 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
62 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
63 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
64 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
65 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
66 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
67 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
68 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
69 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
70 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
71 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
72 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
73 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
74 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
75 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
76 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
77 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
78 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
79 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
80 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
81 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
82 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
83 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
84 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
85 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
86 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
87 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
88 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
89 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
90 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
91 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.67
Metatranscriptomes 0.9
Isolates 32.43

Biome Distribution

Category Percentage (%)
Aerial Root 1.8
Bulb 0
Endosphere 1.8
Nodule 0.9
Rhizoplane 1.8
Rhizosphere 69.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10000019 3300013102 Bacteria 307914
2 rootL2_10198276 3300003322 Bacteria 2687
3 rootH1_10039902 3300003323 Bacteria 8201
4 Ga0006562J51391_1015673 3300003578 Bacteria 1082
5 Ga0055534_1028105 3300003784 Bacteria 883
6 Ga0065714_10064480 3300005288 Bacteria 55164
7 Ga0065714_10534307 3300005288 Bacteria 506
8 Ga0065704_10078777 3300005289 Bacteria 4336
9 Ga0070682_100000055 3300005337 Bacteria 112566
10 Ga0070659_100612741 3300005366 Bacteria 936
11 Ga0070678_101590781 3300005456 Bacteria 613
12 Ga0070684_100008409 3300005535 Bacteria 8065
13 Ga0070672_100563158 3300005543 Bacteria 990
14 Ga0105243_10045534 3300009148 Bacteria 3448
15 Ga0157373_10000032 3300013100 Bacteria 126310
16 Ga0157373_10263725 3300013100 Bacteria 1219
17 Ga0157373_10437658 3300013100 Bacteria 940
18 Ga0157373_11065958 3300013100 Bacteria 605
19 Ga0157371_10052566 3300013102 Bacteria 2894
20 Ga0157371_10055987 3300013102 Bacteria 2797
21 Ga0157370_10003940 3300013104 Bacteria 17279
22 Ga0157370_10148244 3300013104 Bacteria 2184
23 Ga0157369_10000019 3300013105 Bacteria 243437
24 Ga0157369_10382674 3300013105 Bacteria 1460
25 Ga0157375_10000866 3300013308 Bacteria 26337
26 Ga0157375_10168558 3300013308 Bacteria 2336
27 Ga0182008_10000003 3300014497 Bacteria 456880
28 Ga0182006_1000001 3300015261 Bacteria 1091090
29 Ga0163161_10146243 3300017792 Bacteria 1793
30 Ga0209675_1000066 3300025291 Bacteria 171883
31 Ga0207690_10598246 3300025932 Bacteria 900
32 Ga0207661_10024660 3300025944 Bacteria 4560
33 Ga0307412_10000027 3300031911 Bacteria 214663
34 Ga0307412_10000151 3300031911 Bacteria 50287
35 Ga0307412_10007546 3300031911 Bacteria 6177
36 Ga0307416_100000006 3300032002 Bacteria 466074
37 Ga0307414_10000030 3300032004 Bacteria 187373
38 Ga0307414_10253210 3300032004 Bacteria 1465
39 Ga0439466_0052663 3300041411 Bacteria 1330
40 Ga0439465_0000010 3300041413 Bacteria 39572
41 Ga0495627_000022 3300046453 Bacteria 254672
42 Ga0495627_048897 3300046453 Bacteria 1278
43 Ga0495590_0000369 3300046457 Bacteria 22988
44 Ga0495596_0003732 3300046500 Bacteria 7608
45 Ga0495606_0016199 3300046507 Bacteria 5695
46 Ga0495610_0000005 3300046512 Bacteria 924111
47 Ga0495632_0001241 3300046519 Bacteria 21622
48 Ga0495643_0012239 3300046522 Bacteria 5181
49 Ga0495663_0000036 3300046525 Bacteria 70633
50 Ga0495654_0000003 3300046530 Bacteria 863485
51 Ga0495609_0000003 3300046538 Bacteria 711547
52 Ga0495633_0000001 3300046558 Bacteria 801972
53 Ga0495633_0000831 3300046558 Bacteria 27238
54 Ga0495625_0000040 3300046660 Bacteria 207320
55 Ga0495686_0016361 3300047472 Bacteria 5030
56 Ga0496102_0394458 3300048905 Bacteria 1302
57 Ga0496105_0130066 3300048908 Bacteria 2076
58 Ga0496116_0000029 3300048919 Bacteria 422187
59 Ga0496117_0000007 3300048920 Bacteria 720505
60 Ga0496117_0133720 3300048920 Bacteria 1498
61 Ga0496118_0000104 3300048921 Bacteria 157435
62 Ga0496119_0000007 3300048922 Bacteria 475920
63 Ga0496120_0020819 3300048923 Bacteria 4157
64 Ga0496121_0106183 3300048924 Bacteria 2153
65 Ga0496122_0000089 3300048925 Bacteria 206107
66 Ga0496122_0000153 3300048925 Bacteria 161087
67 Ga0496122_0001601 3300048925 Bacteria 35418
68 Ga0496123_0005857 3300048926 Bacteria 12171
69 Ga0496123_0009794 3300048926 Bacteria 8562
70 Ga0496124_0037698 3300048927 Bacteria 4202
71 Ga0496125_0001416 3300048928 Bacteria 35021
72 Ga0496125_0017657 3300048928 Bacteria 6793
73 Ga0496126_0019039 3300048929 Bacteria 6776
74 Ga0496126_0150894 3300048929 Bacteria 1992
75 Ga0501269_000011 3300049766 Bacteria 69171
76 2511232593 2511231000 Bacteria 4488346
77 2524006667 2523533629 Bacteria 2982326
78 2585141048 2582581278 Bacteria 5296881
79 2585157415 2582581281 Bacteria 4487904
80 2585161684 2582581282 Bacteria 4495830
81 2585426049 2582581873 Bacteria 3032664
82 2587746409 2585428060 Bacteria 5304711
83 2587752471 2585428061 Bacteria 3939663
84 2587865918 2585428095 Bacteria 3789702
85 2587944649 2585428115 Bacteria 4420269
86 2588211326 2585428182 Bacteria 5007281
87 2588215701 2585428183 Bacteria 5166119
88 2588219110 2585428184 Bacteria 4978681
89 2588224611 2585428185 Bacteria 4969476
90 2588230842 2585428187 Bacteria 4629388
91 2588447389 2588253712 Bacteria 5403181
92 2590610025 2588254257 Bacteria 5436094
93 2729200974 2728369107 Bacteria 5082720
94 2740060263 2739367874 Bacteria 4872888
95 2765575510 2765235839 Bacteria 5314748
96 2772606368 2772190705 Bacteria 4666226
97 2775674485 2775506739 Bacteria 3855222
98 2816875356 2816332188 Bacteria 5133218
99 2842087210 2842083920 Bacteria 4857652
100 2871723438 2871720351 Bacteria 4862476
101 2889293981 2889290771 Bacteria 5530962
102 2905999159 2905999023 Bacteria 4591259
103 2919098101 2919097161 Bacteria 3860339
104 2919403361 2919399522 Bacteria 5164947
105 2945924933 2945924605 Bacteria 4296724
106 2946023908 2946019816 Bacteria 4621265
107 2977243689 2977243572 Bacteria 4374394
108 2984574316 2984572630 Bacteria 4186940
109 2984607763 2984606641 Bacteria 4186971
110 2993375250 2993372514 Bacteria 4214139
111 2993482114 2993480792 Bacteria 4022225
112 Ga0157371_10000019
113 rootL2_10198276
114 rootH1_10039902
115 Ga0006562J51391_1015673
116 Ga0055534_1028105
117 Ga0065714_10064480
118 Ga0065714_10534307
119 Ga0065704_10078777
120 Ga0070682_100000055
121 Ga0070659_100612741
122 Ga0070678_101590781
123 Ga0070684_100008409
124 Ga0070672_100563158
125 Ga0105243_10045534
126 Ga0157373_10000032
127 Ga0157373_10263725
128 Ga0157373_10437658
129 Ga0157373_11065958
130 Ga0157371_10052566
131 Ga0157371_10055987
132 Ga0157370_10003940
133 Ga0157370_10148244
134 Ga0157369_10000019
135 Ga0157369_10382674
136 Ga0157375_10000866
137 Ga0157375_10168558
138 Ga0182008_10000003
139 Ga0182006_1000001
140 Ga0163161_10146243
141 Ga0209675_1000066
142 Ga0207690_10598246
143 Ga0207661_10024660
144 Ga0307412_10000027
145 Ga0307412_10000151
146 Ga0307412_10007546
147 Ga0307416_100000006
148 Ga0307414_10000030
149 Ga0307414_10253210
150 Ga0439466_0052663
151 Ga0439465_0000010
152 Ga0495627_000022
153 Ga0495627_048897
154 Ga0495590_0000369
155 Ga0495596_0003732
156 Ga0495606_0016199
157 Ga0495610_0000005
158 Ga0495632_0001241
159 Ga0495643_0012239
160 Ga0495663_0000036
161 Ga0495654_0000003
162 Ga0495609_0000003
163 Ga0495633_0000001
164 Ga0495633_0000831
165 Ga0495625_0000040
166 Ga0495686_0016361
167 Ga0496102_0394458
168 Ga0496105_0130066
169 Ga0496116_0000029
170 Ga0496117_0000007
171 Ga0496117_0133720
172 Ga0496118_0000104
173 Ga0496119_0000007
174 Ga0496120_0020819
175 Ga0496121_0106183
176 Ga0496122_0000089
177 Ga0496122_0000153
178 Ga0496122_0001601
179 Ga0496123_0005857
180 Ga0496123_0009794
181 Ga0496124_0037698
182 Ga0496125_0001416
183 Ga0496125_0017657
184 Ga0496126_0019039
185 Ga0496126_0150894
186 Ga0501269_000011
187 2511232593
188 2524006667
189 2585141048
190 2585157415
191 2585161684
192 2585426049
193 2587746409
194 2587752471
195 2587865918
196 2587944649
197 2588211326
198 2588215701
199 2588219110
200 2588224611
201 2588230842
202 2588447389
203 2590610025
204 2729200974
205 2740060263
206 2765575510
207 2772606368
208 2775674485
209 2816875356
210 2842087210
211 2871723438
212 2889293981
213 2905999159
214 2919098101
215 2919403361
216 2945924933
217 2946023908
218 2977243689
219 2984574316
220 2984607763
221 2993375250
222 2993482114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nco-assembly1.cif.gz_j quaternary complex between srp, sr, and secyeg bound to the translating ribosome 0.5268 1 73
7qvm-assembly1.cif.gz_R human oxytocin receptor (otr) oxytocin gq chimera (mgoqi) complex 0.5098 26 94
6vof-assembly1.cif.gz_Z chloroplast atp synthase (o2, cf1fo) 0.5021 3 77
6voh-assembly1.cif.gz_R chloroplast atp synthase (o1, cf1fo) 0.5004 3 78
5nco-assembly1.cif.gz_j quaternary complex between srp, sr, and secyeg bound to the translating ribosome 0.4903 1 73
ID Description Score Start End Superfamily
af_Q7T376_1_103_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5415 2 104 1.20.5.110
af_O60636_1_106_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5202 2 98 1.20.5.110
af_Q86UF1_16_116_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5193 1 100 1.20.120.350
af_O95858_1_114_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5184 4 98 1.20.120.350
af_Q7T376_1_103_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5159 2 104 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A661Y2V2-F1-model_v4 Exosortase F system-associated protein 0.9085 1 96 GO:0016020
AF-A0A661Y2V2-F1-model_v4 Exosortase F system-associated protein 0.883 1 96 GO:0016020
AF-A0A2E8DID0-F1-model_v4 deleted 0.8426 1 75
AF-A0A359DVD4-F1-model_v4 deleted 0.8392 1 124
AF-A0A2E8DID0-F1-model_v4 deleted 0.8232 1 75

Map