F064290

General Info

Members Datasets Scaffolds Average Seq Length
111 88 111 210

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10006341|Ga0213876_100063413
Length 228
Sequence VTRPAVPAIIRAMPVAHGDERREFQRLRLDPPLPATLGESAVTLLDIGVLGARIHHASSLDEHPCELRFTHGANEIVLRCEIVRTFDSEHSKYPGTELESGLRFLAAIGDSGDHLRAMLGELVKALIASRPAPPPIDEQPVDGDKTVRGTQAGFVCYRLDPDATWNRRPVFLPEQPASGFTVARSEDRAEMQRLCAVYAASDDEGRRLIRLFAELSVSEAMEIPPRAQ

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
87 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
88 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10094914 3300005295 Bacteria 3437
2 Ga0070676_10170224 3300005328 Bacteria 1408
3 Ga0070677_10101905 3300005333 Bacteria 1267
4 Ga0070680_100010847 3300005336 Bacteria 7037
5 Ga0070689_100178843 3300005340 Bacteria 1722
6 Ga0070689_100512372 3300005340 Bacteria 1029
7 Ga0070687_100002521 3300005343 Bacteria 6893
8 Ga0070675_100000014 3300005354 Bacteria 206249
9 Ga0070671_100129436 3300005355 Bacteria 2125
10 Ga0070674_100348577 3300005356 Bacteria 1195
11 Ga0070713_100021226 3300005436 Bacteria 4990
12 Ga0070701_10000290 3300005438 Bacteria 16391
13 Ga0070700_100000028 3300005441 Bacteria 121783
14 Ga0070708_100036881 3300005445 Bacteria 4264
15 Ga0070708_100139385 3300005445 Bacteria 2248
16 Ga0070678_100663713 3300005456 Bacteria 936
17 Ga0068867_100191423 3300005459 Bacteria 1632
18 Ga0070685_10032972 3300005466 Bacteria 2905
19 Ga0070706_100006127 3300005467 Bacteria 11374
20 Ga0070706_100821928 3300005467 Unclassified 860
21 Ga0070707_100298957 3300005468 Bacteria 1564
22 Ga0070707_100581148 3300005468 Bacteria 1083
23 Ga0070698_100131077 3300005471 Bacteria 2462
24 Ga0070698_100174824 3300005471 Unclassified 2087
25 Ga0070698_100285116 3300005471 Bacteria 1583
26 Ga0070699_100021849 3300005518 Bacteria 5516
27 Ga0070699_100070718 3300005518 Unclassified 3034
28 Ga0070684_100032503 3300005535 Bacteria 4447
29 Ga0070697_100019787 3300005536 Bacteria 5318
30 Ga0070697_100172760 3300005536 Unclassified 1830
31 Ga0068853_100033169 3300005539 Bacteria 4379
32 Ga0070672_100000026 3300005543 Bacteria 67028
33 Ga0070696_100076377 3300005546 Bacteria 2365
34 Ga0070693_100052007 3300005547 Bacteria 2347
35 Ga0070693_100225771 3300005547 Bacteria 1229
36 Ga0068857_100240370 3300005577 Bacteria 1658
37 Ga0070702_100029268 3300005615 Bacteria 2993
38 Ga0070702_100067423 3300005615 Bacteria 2102
39 Ga0068864_100000001 3300005618 Bacteria 686767
40 Ga0068861_100108568 3300005719 Unclassified 2220
41 Ga0068870_10025500 3300005840 Bacteria 2935
42 Ga0070717_10000068 3300006028 Bacteria 86088
43 Ga0070717_10487630 3300006028 Archaea 1113
44 Ga0070717_10579666 3300006028 Bacteria 1017
45 Ga0070716_100202407 3300006173 Bacteria 1321
46 Ga0075428_100049569 3300006844 Bacteria 4607
47 Ga0075431_100010906 3300006847 Bacteria 9142
48 Ga0075429_100175367 3300006880 Bacteria 1878
49 Ga0075435_100003900 3300007076 Bacteria 10187
50 Ga0075435_100013114 3300007076 Bacteria 6157
51 Ga0105244_10218872 3300009036 Unclassified 893
52 Ga0105240_10301447 3300009093 Bacteria 1833
53 Ga0111539_10000003 3300009094 Bacteria 880006
54 Ga0105245_10000268 3300009098 Bacteria 49610
55 Ga0105245_10226670 3300009098 Bacteria 1806
56 Ga0114129_10189536 3300009147 Bacteria 2794
57 Ga0105242_10546997 3300009176 Bacteria 1109
58 Ga0105239_10092754 3300010375 Bacteria 3334
59 Ga0157371_10247930 3300013102 Bacteria 1282
60 Ga0157369_10965487 3300013105 Bacteria 873
61 Ga0163162_10002467 3300013306 Bacteria 17468
62 Ga0163162_10319031 3300013306 Bacteria 1686
63 Ga0157375_10000028 3300013308 Bacteria 218924
64 Ga0157380_10000625 3300014326 Bacteria 21697
65 Ga0157377_10000085 3300014745 Bacteria 70930
66 Ga0157377_10417537 3300014745 Bacteria 918
67 Ga0213873_10000001 3300021358 Bacteria 1657979
68 Ga0213876_10000002 3300021384 Bacteria 1168769
69 Ga0213876_10006341 3300021384 Bacteria 6447
70 Ga0207655_1116886 3300025728 Unclassified 890
71 Ga0207682_10136043 3300025893 Bacteria 1100
72 Ga0207643_10030678 3300025908 Bacteria 2994
73 Ga0207684_10083910 3300025910 Bacteria 2713
74 Ga0207695_10040830 3300025913 Bacteria 4969
75 Ga0207660_10117048 3300025917 Bacteria 2014
76 Ga0207662_10007409 3300025918 Bacteria 5975
77 Ga0207646_10141323 3300025922 Bacteria 2168
78 Ga0207646_10163058 3300025922 Bacteria 2012
79 Ga0207646_10180762 3300025922 Bacteria 1905
80 Ga0207646_10203679 3300025922 Bacteria 1787
81 Ga0207659_10000001 3300025926 Bacteria 660958
82 Ga0207687_10001283 3300025927 Bacteria 17188
83 Ga0207700_10025677 3300025928 Unclassified 4096
84 Ga0207644_10073834 3300025931 Unclassified 2502
85 Ga0207686_10461613 3300025934 Bacteria 979
86 Ga0207669_10115385 3300025937 Bacteria 1810
87 Ga0207665_10302121 3300025939 Bacteria 1197
88 Ga0207665_10636349 3300025939 Unclassified 835
89 Ga0207691_10001584 3300025940 Bacteria 22589
90 Ga0207639_10000005 3300026041 Bacteria 579948
91 Ga0207708_10000003 3300026075 Bacteria 324662
92 Ga0207648_10210076 3300026089 Bacteria 1727
93 Ga0207676_10000002 3300026095 Bacteria 1198607
94 Ga0207675_100057464 3300026118 Bacteria 3630
95 Ga0207683_10333997 3300026121 Bacteria 1389
96 Ga0207428_10000001 3300027907 Bacteria 1034622
97 Ga0307516_10304437 3300031730 Bacteria 1269
98 Ga0373932_0000398 3300035112 Bacteria 13386
99 Ga0436365_1159326 3300039437 Bacteria 152569
100 Ga0436365_1208035 3300039437 Bacteria 5002
101 Ga0436365_1239841 3300039437 Bacteria 13192
102 Ga0436362_0984254 3300039453 Bacteria 405590
103 Ga0453683_0022277 3300044673 Bacteria 4042
104 Ga0466958_0158556 3300045836 Bacteria 1429
105 Ga0495620_0000318 3300046515 Bacteria 34349
106 nmdc:mga05p37_117536_c1 3300050507 Unclassified 3267
107 nmdc:mga06r32_2621_c1 3300050510 Bacteria 16055
108 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
109 nmdc:mga0n895_349043_c1 3300050512 Bacteria 1498
110 nmdc:mga0rr50_26_c1 3300050513 Bacteria 110468
111 Ga0495655_0000124 3300053083 Bacteria 14183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1159326 Ga0436365_1159326_136474_137001 175
2 3300039453 Ga0436362_0984254 Ga0436362_0984254_98665_99192 175
3 3300005471 Ga0070698_100285116 Ga0070698_1002851162 192
4 3300025939 Ga0207665_10636349 Ga0207665_106363492 193
5 3300005459 Ga0068867_100191423 Ga0068867_1001914232 196
6 3300006173 Ga0070716_100202407 Ga0070716_1002024072 201
7 3300025939 Ga0207665_10302121 Ga0207665_103021212 201
8 3300039437 Ga0436365_1208035 Ga0436365_1208035_2272_2880 202
9 3300005441 Ga0070700_100000028 Ga0070700_10000002811 204
10 3300005445 Ga0070708_100139385 Ga0070708_1001393852 204
11 3300005467 Ga0070706_100006127 Ga0070706_1000061272 204
12 3300005518 Ga0070699_100070718 Ga0070699_1000707182 204
13 3300005536 Ga0070697_100172760 Ga0070697_1001727601 204
14 3300026075 Ga0207708_10000003 Ga0207708_10000003245 204
15 3300046515 Ga0495620_0000318 Ga0495620_0000318_22462_23076 204
16 3300005328 Ga0070676_10170224 Ga0070676_101702242 205
17 3300005336 Ga0070680_100010847 Ga0070680_1000108472 205
18 3300005354 Ga0070675_100000014 Ga0070675_100000014131 205
19 3300005615 Ga0070702_100067423 Ga0070702_1000674231 205
20 3300005719 Ga0068861_100108568 Ga0068861_1001085682 205
21 3300006028 Ga0070717_10487630 Ga0070717_104876302 205
22 3300006847 Ga0075431_100010906 Ga0075431_1000109067 205
23 3300009036 Ga0105244_10218872 Ga0105244_102188722 205
24 3300009147 Ga0114129_10189536 Ga0114129_101895362 205
25 3300013306 Ga0163162_10319031 Ga0163162_103190312 205
26 3300025728 Ga0207655_1116886 Ga0207655_11168861 205
27 3300025917 Ga0207660_10117048 Ga0207660_101170482 205
28 3300025926 Ga0207659_10000001 Ga0207659_10000001547 205
29 3300026118 Ga0207675_100057464 Ga0207675_1000574642 205
30 3300050507 nmdc:mga05p37_117536_c1 nmdc:mga05p37_117536_c1_1480_2106 205
31 3300050510 nmdc:mga06r32_2621_c1 nmdc:mga06r32_2621_c1_7426_8043 205
32 3300005467 Ga0070706_100821928 Ga0070706_1008219282 206
33 3300005468 Ga0070707_100298957 Ga0070707_1002989572 206
34 3300005468 Ga0070707_100581148 Ga0070707_1005811482 206
35 3300005471 Ga0070698_100131077 Ga0070698_1001310772 206
36 3300005471 Ga0070698_100174824 Ga0070698_1001748242 206
37 3300006844 Ga0075428_100049569 Ga0075428_1000495697 206
38 3300025922 Ga0207646_10163058 Ga0207646_101630582 206
39 3300025922 Ga0207646_10203679 Ga0207646_102036791 206
40 3300045836 Ga0466958_0158556 Ga0466958_0158556_667_1308 206
41 3300006028 Ga0070717_10579666 Ga0070717_105796662 207
42 3300005436 Ga0070713_100021226 Ga0070713_1000212266 208
43 3300006028 Ga0070717_10000068 Ga0070717_1000006879 208
44 3300025928 Ga0207700_10025677 Ga0207700_100256772 208
45 3300053083 Ga0495655_0000124 Ga0495655_0000124_13010_13657 208
46 3300005340 Ga0070689_100512372 Ga0070689_1005123722 209
47 3300005356 Ga0070674_100348577 Ga0070674_1003485772 209
48 3300007076 Ga0075435_100003900 Ga0075435_10000390013 209
49 3300014745 Ga0157377_10000085 Ga0157377_1000008553 209
50 3300025937 Ga0207669_10115385 Ga0207669_101153852 209
51 3300050513 nmdc:mga0rr50_26_c1 nmdc:mga0rr50_26_c1_109082_109711 209
52 3300007076 Ga0075435_100013114 Ga0075435_1000131144 210
53 3300009098 Ga0105245_10000268 Ga0105245_1000026851 210
54 3300013306 Ga0163162_10002467 Ga0163162_100024672 210
55 3300025927 Ga0207687_10001283 Ga0207687_100012833 210
56 3300035112 Ga0373932_0000398 Ga0373932_0000398_2165_2800 210
57 3300050512 nmdc:mga0n895_349043_c1 nmdc:mga0n895_349043_c1_310_942 210
58 3300005333 Ga0070677_10101905 Ga0070677_101019052 211
59 3300005343 Ga0070687_100002521 Ga0070687_1000025214 211
60 3300005438 Ga0070701_10000290 Ga0070701_1000029018 211
61 3300005535 Ga0070684_100032503 Ga0070684_1000325035 211
62 3300005543 Ga0070672_100000026 Ga0070672_1000000269 211
63 3300005546 Ga0070696_100076377 Ga0070696_1000763773 211
64 3300005547 Ga0070693_100052007 Ga0070693_1000520071 211
65 3300005547 Ga0070693_100225771 Ga0070693_1002257712 211
66 3300005577 Ga0068857_100240370 Ga0068857_1002403702 211
67 3300005618 Ga0068864_100000001 Ga0068864_10000000133 211
68 3300009098 Ga0105245_10226670 Ga0105245_102266702 211
69 3300009176 Ga0105242_10546997 Ga0105242_105469972 211
70 3300010375 Ga0105239_10092754 Ga0105239_100927542 211
71 3300013308 Ga0157375_10000028 Ga0157375_10000028104 211
72 3300014326 Ga0157380_10000625 Ga0157380_1000062520 211
73 3300014745 Ga0157377_10417537 Ga0157377_104175372 211
74 3300025893 Ga0207682_10136043 Ga0207682_101360432 211
75 3300025918 Ga0207662_10007409 Ga0207662_100074095 211
76 3300025922 Ga0207646_10180762 Ga0207646_101807622 211
77 3300025934 Ga0207686_10461613 Ga0207686_104616132 211
78 3300025940 Ga0207691_10001584 Ga0207691_1000158414 211
79 3300026089 Ga0207648_10210076 Ga0207648_102100762 211
80 3300026095 Ga0207676_10000002 Ga0207676_10000002801 211
81 3300005445 Ga0070708_100036881 Ga0070708_1000368813 212
82 3300005466 Ga0070685_10032972 Ga0070685_100329722 212
83 3300005536 Ga0070697_100019787 Ga0070697_1000197872 212
84 3300005539 Ga0068853_100033169 Ga0068853_1000331694 212
85 3300005840 Ga0068870_10025500 Ga0068870_100255002 212
86 3300009093 Ga0105240_10301447 Ga0105240_103014472 212
87 3300013102 Ga0157371_10247930 Ga0157371_102479302 212
88 3300013105 Ga0157369_10965487 Ga0157369_109654871 212
89 3300025908 Ga0207643_10030678 Ga0207643_100306782 212
90 3300025910 Ga0207684_10083910 Ga0207684_100839102 212
91 3300025913 Ga0207695_10040830 Ga0207695_100408301 212
92 3300026041 Ga0207639_10000005 Ga0207639_10000005236 212
93 3300005340 Ga0070689_100178843 Ga0070689_1001788432 213
94 3300021384 Ga0213876_10006341 Ga0213876_100063413 213
95 3300039437 Ga0436365_1239841 Ga0436365_1239841_4597_5247 213
96 3300005355 Ga0070671_100129436 Ga0070671_1001294361 214
97 3300005456 Ga0070678_100663713 Ga0070678_1006637132 214
98 3300005518 Ga0070699_100021849 Ga0070699_1000218492 214
99 3300005615 Ga0070702_100029268 Ga0070702_1000292682 214
100 3300025922 Ga0207646_10141323 Ga0207646_101413233 214
101 3300025931 Ga0207644_10073834 Ga0207644_100738342 214
102 3300026121 Ga0207683_10333997 Ga0207683_103339972 214
103 3300044673 Ga0453683_0022277 Ga0453683_0022277_1134_1790 214
104 3300005295 Ga0065707_10094914 Ga0065707_100949142 215
105 3300006880 Ga0075429_100175367 Ga0075429_1001753672 215
106 3300009094 Ga0111539_10000003 Ga0111539_10000003631 215
107 3300021358 Ga0213873_10000001 Ga0213873_10000001843 215
108 3300021384 Ga0213876_10000002 Ga0213876_10000002699 215
109 3300027907 Ga0207428_10000001 Ga0207428_10000001778 215
110 3300031730 Ga0307516_10304437 Ga0307516_103044372 215
111 3300050511 nmdc:mga08y16_1_c1 nmdc:mga08y16_1_c1_172568_173215 215

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kgo-assembly2.cif.gz_A structure of k. pneumonia mrkh-c-di-gmp complex 0.7212 9 116
4q63-assembly1.cif.gz_A crystal structure of legionella uncharacterized protein lpg0364 0.7144 11 119
4q63-assembly1.cif.gz_A crystal structure of legionella uncharacterized protein lpg0364 0.7012 11 119
5kec-assembly3.cif.gz_D structure of k. pneumonia mrkh in its apo state. 0.6941 12 116
5y6f-assembly1.cif.gz_A crystal structure of ycgr in complex with c-di-gmp from escherichia coli 0.6922 8 119
ID Description Score Start End Superfamily
4q63A00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7107 11 119 2.40.10.430
4q63A00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.6982 11 119 2.40.10.430
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6913 9 116 2.40.10.220
af_B3DFU6_305_380_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.6783 19 96 2.40.10.10
af_P37653_690_796_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6717 1 102 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A2V7WRL5-F1-model_v4 Transcriptional regulator 0.95 140 215
AF-A0A2V7WRL5-F1-model_v4 Transcriptional regulator 0.9141 140 215
AF-A0A523DC29-F1-model_v4 PilZ domain-containing protein 0.8462 27 107 GO:0035438
AF-A0A315XBW4-F1-model_v4 PilZ domain-containing protein 0.8319 8 119 GO:0035438
AF-A0A2V7YLE1-F1-model_v4 PilZ domain-containing protein 0.83 4 119 GO:0035438

Feature Viewer

pLDDT pTM Quality
80.57 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map