F070157

General Info

Members Datasets Scaffolds Average Seq Length
112 80 224 688

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_18908|Ga0400485_18908_2784_4979
Length 731
Sequence MPSTRSHPHPLGVHPCAAGAEVAVFASSAEAVEFCLLDRDSSGEWRERRTPLPHHRHGVWFGTVPDVRPGQRYGLRAHGPWDPARGLRFNPAKLLLDPYARAHSGTLRLRPELFGHTVDDRFVGDTAVPDPRDSAPHAPHGIVVGAGALWGADEPPDIPWSDTVIYEAHVSGLTRRLPGVPEPLRGTYAGLAHDATLDYLTGLGVTAVELLPVQAIGTEPALARRGRVNYWGYSTLGFFAPHPGYAAATDPLAVLEEFRHLVRRLHGAGLELILDVVLNHTCETDETGPTLSWRGLDAPAYYLLDDRGRHWDTTGCGNSLNARHPRVVQMMLDSLRYWVESAHVDGFRFDLAPTLARGRDGFDPDHPFLVAARADPVLQRVKLIAEPWDVGPRGWRTGQFPPPFAEWNDRFRDTARHFWLSAPAGADPGDGIRALATRLAGSDDLFSADRGPLASVNFITAHDGFTLADLTAYDRKHNEENGXXXRDGSDLNLSWNHGTEGATTDPDILAARRRSARNLLGTLLLSAGVPMLVAGDERGRTQGGNNNPYCVDGPTTWLDWHAEASRTDLTETVRFLLALRRDHPVLRQERSFADRVTQPDGSRDIVWFGDDGRELGDAQWSDPRQRIVQLLLTGPDEGSGTGSVLLVVQGSXQGTRIRLPEPPGRQSWYRLLWDSVDERPGPARNRPVEPAGTVVTVAGPSVRVYAVLRDGTGEPAGTGGSGVGDQSEFGG

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
9 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
10 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
12 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
13 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
14 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
15 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
16 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
17 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
18 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
19 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
20 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
21 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
22 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
23 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
24 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
25 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
26 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
27 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
28 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
29 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
30 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
31 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
32 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
33 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
34 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
35 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
36 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
37 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
38 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
39 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
40 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
41 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
42 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
43 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
44 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
45 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
46 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
47 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
49 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
50 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
51 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
52 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
53 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
54 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
55 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
56 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
57 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
58 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
59 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
60 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
61 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
62 2643221575 Microbacterium sp. Root61 Isolate Unclassified
63 2643221597 Microbacterium sp. Root180 Isolate Unclassified
64 2643221616 Leifsonia sp. Root227 Isolate Unclassified
65 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
66 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
67 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
68 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
69 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
70 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
71 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
72 2919069694 Microbacterium sp. 1154 Isolate Unclassified
73 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
74 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
75 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
76 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
77 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
78 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
79 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
80 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.14
Metatranscriptomes 0
Isolates 17.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.89
Bulb 0
Endosphere 24.11
Nodule 0
Rhizoplane 6.25
Rhizosphere 31.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_18908 3300038735 Bacteria 69934
2 Ga0070658_10083537 3300005327 Bacteria 2625
3 Ga0070707_100013334 3300005468 Bacteria 7689
4 Ga0068855_100100197 3300005563 Bacteria 3336
5 Ga0081539_10000376 3300005985 Bacteria 97498
6 Ga0075365_10004965 3300006038 Bacteria 7120
7 Ga0075365_10024265 3300006038 Bacteria 3822
8 Ga0075367_10004760 3300006178 Bacteria 6675
9 Ga0075369_10010980 3300006186 Bacteria 3553
10 Ga0075369_10011224 3300006186 Bacteria 3521
11 Ga0157371_10003552 3300013102 Bacteria 14069
12 Ga0207705_10000213 3300025909 Bacteria 58174
13 Ga0265334_10015795 3300028573 Bacteria 3132
14 Ga0307515_10037529 3300028794 Bacteria 7789
15 Ga0265340_10001445 3300031247 Bacteria 13625
16 Ga0307513_10036728 3300031456 Bacteria 5460
17 Ga0307408_100008194 3300031548 Bacteria 6904
18 Ga0307406_10014855 3300031901 Bacteria 4489
19 Ga0307409_100002974 3300031995 Bacteria 9032
20 Ga0307416_100006566 3300032002 Bacteria 7295
21 Ga0400486_03657 3300038742 Bacteria 72353
22 Ga0451793_1205611 3300041452 Bacteria 3017
23 Ga0466965_0029458 3300044683 Bacteria 2672
24 Ga0495590_0000242 3300046457 Bacteria 29848
25 Ga0495650_0001013 3300046471 Bacteria 31698
26 Ga0495672_0005490 3300047320 Bacteria 10049
27 Ga0496104_0016669 3300048907 Bacteria 6677
28 Ga0496105_0006436 3300048908 Bacteria 9029
29 Ga0496109_0057393 3300048912 Bacteria 3553
30 Ga0496109_0087058 3300048912 Bacteria 2885
31 Ga0496114_0023105 3300048917 Bacteria 5069
32 Ga0496114_0024783 3300048917 Bacteria 4898
33 Ga0496116_0008426 3300048919 Bacteria 8947
34 Ga0496117_0000053 3300048920 Bacteria 279396
35 Ga0496117_0001576 3300048920 Bacteria 32370
36 Ga0496117_0005515 3300048920 Bacteria 13253
37 Ga0496117_0010858 3300048920 Bacteria 8215
38 Ga0496118_0010413 3300048921 Bacteria 9214
39 Ga0496118_0025935 3300048921 Bacteria 5009
40 Ga0496119_0003914 3300048922 Bacteria 15123
41 Ga0496119_0007824 3300048922 Bacteria 9528
42 Ga0496120_0001117 3300048923 Bacteria 34800
43 Ga0496120_0002581 3300048923 Bacteria 18038
44 Ga0496120_0002782 3300048923 Bacteria 16983
45 Ga0496120_0027958 3300048923 Bacteria 3462
46 Ga0496122_0000031 3300048925 Bacteria 329726
47 Ga0496122_0000194 3300048925 Bacteria 139191
48 Ga0496123_0000013 3300048926 Bacteria 439694
49 Ga0496123_0000350 3300048926 Bacteria 86569
50 Ga0496123_0000681 3300048926 Bacteria 56018
51 Ga0496123_0037629 3300048926 Bacteria 3414
52 Ga0496124_0003767 3300048927 Bacteria 18240
53 Ga0496124_0008895 3300048927 Bacteria 10415
54 Ga0496124_0023149 3300048927 Bacteria 5679
55 Ga0496125_0000077 3300048928 Bacteria 232629
56 Ga0496126_0014786 3300048929 Bacteria 7873
57 Ga0496126_0046112 3300048929 Bacteria 4001
58 Ga0496126_0059818 3300048929 Bacteria 3430
59 Ga0501034_0000954 3300049571 Bacteria 41786
60 Ga0501034_0120170 3300049571 Bacteria 2614
61 Ga0501034_0126012 3300049571 Bacteria 2546
62 Ga0501036_0025038 3300049572 Bacteria 5033
63 Ga0501042_0002289 3300049578 Bacteria 11699
64 Ga0501047_0021954 3300049581 Bacteria 6130
65 Ga0501070_0006307 3300049586 Bacteria 10093
66 Ga0501073_0009672 3300049589 Bacteria 7108
67 Ga0501076_0007529 3300049592 Bacteria 7922
68 Ga0501083_0000031 3300049744 Bacteria 104819
69 Ga0501035_0068450 3300049822 Bacteria 3148
70 Ga0501045_0019946 3300049824 Bacteria 4784
71 nmdc:mga00v17_20095_c1 3300050491 Bacteria 3822
72 nmdc:mga0yw44_29843_c1 3300050492 Bacteria 3153
73 nmdc:mga06z11_5837_c1 3300050494 Bacteria 4970
74 nmdc:mga0sz30_15359_c1 3300050516 Bacteria 3025
75 nmdc:mga0sz30_5879_c1 3300050516 Bacteria 4525
76 Ga0500635_0000010 3300053080 Bacteria 147500
77 Ga0500643_000072 3300053087 Bacteria 112810
78 Ga0500556_0000001 3300053104 Bacteria 1135060
79 Ga0500556_0000086 3300053104 Bacteria 87063
80 Ga0500562_000397 3300053108 Bacteria 10573
81 Ga0500559_0000063 3300053136 Bacteria 87005
82 Ga0500559_0002714 3300053136 Bacteria 8990
83 Ga0500568_0000006 3300053139 Bacteria 522235
84 Ga0500568_0000028 3300053139 Bacteria 161589
85 Ga0500568_0000102 3300053139 Bacteria 78197
86 Ga0500573_0000001 3300053140 Bacteria 436394
87 Ga0500573_0016225 3300053140 Bacteria 4226
88 Ga0500573_0018046 3300053140 Bacteria 4020
89 Ga0500616_0000078 3300053153 Bacteria 202009
90 Ga0500616_0000337 3300053153 Bacteria 66968
91 Ga0500616_0005582 3300053153 Bacteria 8502
92 Ga0500616_0012935 3300053153 Bacteria 4863
93 2537897607 2537561592 Bacteria 4348607
94 2643885244 2643221575 Bacteria 4022601
95 2643996042 2643221597 Bacteria 3347721
96 2644095775 2643221616 Bacteria 4066575
97 2774380221 2773857758 Bacteria 3592392
98 2809227561 2808606447 Bacteria 3572005
99 2812323362 2811994872 Bacteria 4121241
100 2852634322 2852632344 Bacteria 3463163
101 2870624206 2870622029 Bacteria 3643329
102 2904511846 2904509784 Bacteria 3520416
103 2908680763 2908678064 Bacteria 3482747
104 2919071688 2919069694 Bacteria 3622919
105 2939658679 2939657138 Bacteria 3740283
106 2974297313 2974294766 Bacteria 3767688
107 2974326448 2974324384 Bacteria 3750535
108 2977236917 2977236895 Bacteria 3569373
109 2977266789 2977264416 Bacteria 3750737
110 2984545293 2984542743 Bacteria 3569378
111 8016257398 8016254467 Bacteria 3797036
112 8057347861 8057345674 Bacteria 4160394
113 Ga0400485_18908
114 Ga0070658_10083537
115 Ga0070707_100013334
116 Ga0068855_100100197
117 Ga0081539_10000376
118 Ga0075365_10004965
119 Ga0075365_10024265
120 Ga0075367_10004760
121 Ga0075369_10010980
122 Ga0075369_10011224
123 Ga0157371_10003552
124 Ga0207705_10000213
125 Ga0265334_10015795
126 Ga0307515_10037529
127 Ga0265340_10001445
128 Ga0307513_10036728
129 Ga0307408_100008194
130 Ga0307406_10014855
131 Ga0307409_100002974
132 Ga0307416_100006566
133 Ga0400486_03657
134 Ga0451793_1205611
135 Ga0466965_0029458
136 Ga0495590_0000242
137 Ga0495650_0001013
138 Ga0495672_0005490
139 Ga0496104_0016669
140 Ga0496105_0006436
141 Ga0496109_0057393
142 Ga0496109_0087058
143 Ga0496114_0023105
144 Ga0496114_0024783
145 Ga0496116_0008426
146 Ga0496117_0000053
147 Ga0496117_0001576
148 Ga0496117_0005515
149 Ga0496117_0010858
150 Ga0496118_0010413
151 Ga0496118_0025935
152 Ga0496119_0003914
153 Ga0496119_0007824
154 Ga0496120_0001117
155 Ga0496120_0002581
156 Ga0496120_0002782
157 Ga0496120_0027958
158 Ga0496122_0000031
159 Ga0496122_0000194
160 Ga0496123_0000013
161 Ga0496123_0000350
162 Ga0496123_0000681
163 Ga0496123_0037629
164 Ga0496124_0003767
165 Ga0496124_0008895
166 Ga0496124_0023149
167 Ga0496125_0000077
168 Ga0496126_0014786
169 Ga0496126_0046112
170 Ga0496126_0059818
171 Ga0501034_0000954
172 Ga0501034_0120170
173 Ga0501034_0126012
174 Ga0501036_0025038
175 Ga0501042_0002289
176 Ga0501047_0021954
177 Ga0501070_0006307
178 Ga0501073_0009672
179 Ga0501076_0007529
180 Ga0501083_0000031
181 Ga0501035_0068450
182 Ga0501045_0019946
183 nmdc:mga00v17_20095_c1
184 nmdc:mga0yw44_29843_c1
185 nmdc:mga06z11_5837_c1
186 nmdc:mga0sz30_15359_c1
187 nmdc:mga0sz30_5879_c1
188 Ga0500635_0000010
189 Ga0500643_000072
190 Ga0500556_0000001
191 Ga0500556_0000086
192 Ga0500562_000397
193 Ga0500559_0000063
194 Ga0500559_0002714
195 Ga0500568_0000006
196 Ga0500568_0000028
197 Ga0500568_0000102
198 Ga0500573_0000001
199 Ga0500573_0016225
200 Ga0500573_0018046
201 Ga0500616_0000078
202 Ga0500616_0000337
203 Ga0500616_0005582
204 Ga0500616_0012935
205 2537897607
206 2643885244
207 2643996042
208 2644095775
209 2774380221
210 2809227561
211 2812323362
212 2852634322
213 2870624206
214 2904511846
215 2908680763
216 2919071688
217 2939658679
218 2974297313
219 2974326448
220 2977236917
221 2977266789
222 2984545293
223 8016257398
224 8057347861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02922

CBM_48

Carbohydrate-binding module 48 (Isoamylase N-terminal domain)

10

100

0.93

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

186

303

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u3b-assembly4.cif.gz_G structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.8967 15 687
7u3b-assembly1.cif.gz_C structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.8967 15 687
7u3a-assembly1.cif.gz_A structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.8934 15 687
7u3a-assembly1.cif.gz_B structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.8924 15 685
7u3b-assembly2.cif.gz_F structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.8923 15 685
ID Description Score Start End Superfamily
2wskA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9214 124 571 3.20.20.80
2vuyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9054 123 575 3.20.20.80
2vuyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.902 123 575 3.20.20.80
2wskA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8993 124 571 3.20.20.80
2vuyA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8974 15 119 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7Y9MFF4-F1-model_v4 Glycogen operon protein (EC 3.2.1.-) 0.9659 12 687 GO:0004133
GO:0004553
GO:0005980
AF-A0A443IWY1-F1-model_v4 Glycogen debranching enzyme 0.9653 254 451
AF-A0A1Y6EJ55-F1-model_v4 Glycogen operon protein 0.9647 12 687 GO:0004133
GO:0004553
GO:0005980
AF-A0A0Q5EF18-F1-model_v4 Glycosyl hydrolase 0.9645 12 687 GO:0004133
GO:0004553
GO:0005980
AF-A0A6P1FFG6-F1-model_v4 Glycogen debranching protein GlgX 0.9639 13 687 GO:0004133
GO:0004553
GO:0005980

Map