F070295

General Info

Members Datasets Scaffolds Average Seq Length
112 61 224 420

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0137703|Ga0451577_0137703_607_2004
Length 465
Sequence LSDGGVRSAIVSKPAMASTYQIGGFDMFLTFAGNYSTTEVQNMEFSTSLDFAKQLDGQDALASYHEQFVSNDPDLIYLDGNSLGRLPKSVVARMQKVVEEEWGTDLIRGWNRGWWDSPSRIGDKIGSLLGAANGQVIVGDQTSINLFKLATAALTLQPQKKRIITDTFNFPSDLYILQGLVKLLGDQHEIIRIGAVDNDITPDLTALENVIDEDTALMTLSHVTFKSGYLYDMASITELAHRKGALVLWDLSHSVGAVPIELDQSDVDFAIGCTYKYLNGGPGAPAFLYVNKKIQNDVSSPIWGWWGQNDPFTFDLEYQPAPGVQRLLAGTAPMISTLAMEEALTPLLEAGIESLRAKSILMTDYASYLTDELLAPLGFTLGSPRDSARRGSHISIRHEEGYRINRAMIEEMNVIPDFREPDNIRLGFAPLYISFADIWEGFDRIRRVVQEERFEKYPKQKLKVT

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
30 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
32 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
33 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
36 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
39 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
40 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
41 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
42 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
43 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
44 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
45 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
46 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
47 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
48 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
49 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
50 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
51 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
52 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
54 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
55 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
56 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
57 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
58 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
59 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
60 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
61 2643221679 Angustibacter sp. Root456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.93
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0137703 3300042876 Bacteria 2193
2 SwRhRL3b_contig_1156335 2162886006 Bacteria 2068
3 SwRhRL3b_contig_1370232 2162886006 Bacteria 2035
4 SwRhRL2b_contig_673901 2162886007 Bacteria 3494
5 JGI25406J46586_10006358 3300003203 Bacteria 5449
6 Ga0065704_10000250 3300005289 Bacteria 52865
7 Ga0065704_10002788 3300005289 Bacteria 6364
8 Ga0065707_10003048 3300005295 Bacteria 7295
9 Ga0065707_10085611 3300005295 Bacteria 6022
10 Ga0070683_100101829 3300005329 Bacteria 2705
11 Ga0070694_100067306 3300005444 Bacteria 2459
12 Ga0070698_100056688 3300005471 Bacteria 3969
13 Ga0070699_100009388 3300005518 Bacteria 8474
14 Ga0070684_100029623 3300005535 Bacteria 4641
15 Ga0070695_100104977 3300005545 Bacteria 1908
16 Ga0070702_100034069 3300005615 Bacteria 2805
17 Ga0068864_100186951 3300005618 Bacteria 1897
18 Ga0081455_10000128 3300005937 Bacteria 88444
19 Ga0081455_10004594 3300005937 Bacteria 15414
20 Ga0081539_10005925 3300005985 Bacteria 12071
21 Ga0075427_10000024 3300006194 Bacteria 10176
22 Ga0075428_100004427 3300006844 Bacteria 15513
23 Ga0075428_100076717 3300006844 Bacteria 3649
24 Ga0075430_100051341 3300006846 Bacteria 3476
25 Ga0075430_100068113 3300006846 Bacteria 2987
26 Ga0075430_100229390 3300006846 Bacteria 1540
27 Ga0075433_10217642 3300006852 Bacteria 1697
28 Ga0075429_100008134 3300006880 Bacteria 9118
29 Ga0075429_100041424 3300006880 Bacteria 4011
30 Ga0075429_100041947 3300006880 Bacteria 3983
31 Ga0111539_10007718 3300009094 Bacteria 13745
32 Ga0111539_10223222 3300009094 Bacteria 2194
33 Ga0114129_10000238 3300009147 Bacteria 61413
34 Ga0114129_10004517 3300009147 Bacteria 19638
35 Ga0114129_10147959 3300009147 Bacteria 3216
36 Ga0114129_10203721 3300009147 Bacteria 2678
37 Ga0105243_10108691 3300009148 Bacteria 2315
38 Ga0105243_10200862 3300009148 Bacteria 1748
39 Ga0163162_10189659 3300013306 Bacteria 2183
40 Ga0157380_10113576 3300014326 Bacteria 2281
41 Ga0207709_10053168 3300025935 Bacteria 2491
42 Ga0207661_10197720 3300025944 Bacteria 1766
43 Ga0207428_10001938 3300027907 Bacteria 20972
44 Ga0268265_10248441 3300028380 Bacteria 1574
45 Ga0265318_10016597 3300028577 Bacteria 3040
46 Ga0316575_10013337 3300031665 Bacteria 3069
47 Ga0316577_10007122 3300031733 Bacteria 5951
48 Ga0316577_10035800 3300031733 Bacteria 2775
49 Ga0307413_10079462 3300031824 Bacteria 2097
50 Ga0316585_10000534 3300032137 Bacteria 9164
51 Ga0316585_10030014 3300032137 Bacteria 1705
52 Ga0316582_0013706 3300036647 Bacteria 4572
53 Ga0316584_0016230 3300036712 Bacteria 5338
54 Ga0316584_0020035 3300036712 Bacteria 4844
55 Ga0316584_0028026 3300036712 Bacteria 4150
56 Ga0316584_0035821 3300036712 Bacteria 3682
57 Ga0316584_0037600 3300036712 Bacteria 3597
58 Ga0451577_0050501 3300042876 Bacteria 3712
59 Ga0451577_0054445 3300042876 Bacteria 3571
60 Ga0451577_0064242 3300042876 Bacteria 3273
61 Ga0453683_0002062 3300044673 Bacteria 16093
62 Ga0453683_0005478 3300044673 Bacteria 8855
63 Ga0453683_0009903 3300044673 Bacteria 6343
64 Ga0453683_0045205 3300044673 Bacteria 2762
65 Ga0453684_0000003 3300044712 Bacteria 1481694
66 Ga0453684_0000564 3300044712 Bacteria 139611
67 Ga0453684_0008011 3300044712 Bacteria 19128
68 Ga0453684_0012601 3300044712 Bacteria 13908
69 Ga0453684_0021735 3300044712 Bacteria 9566
70 Ga0453684_0032063 3300044712 Bacteria 7367
71 Ga0453684_0032160 3300044712 Bacteria 7352
72 Ga0453684_0057589 3300044712 Bacteria 5028
73 Ga0453684_0059113 3300044712 Bacteria 4946
74 Ga0453684_0069982 3300044712 Bacteria 4447
75 Ga0453684_0078098 3300044712 Unclassified 4144
76 Ga0453684_0166378 3300044712 Bacteria 2603
77 Ga0453684_0198586 3300044712 Bacteria 2340
78 Ga0453684_0209624 3300044712 Bacteria 2266
79 Ga0453684_0259818 3300044712 Bacteria 1990
80 Ga0453684_0313362 3300044712 Bacteria 1779
81 Ga0451576_0000189 3300045051 Bacteria 155001
82 Ga0451576_0008748 3300045051 Bacteria 11845
83 Ga0451576_0077068 3300045051 Bacteria 3469
84 Ga0451576_0116157 3300045051 Bacteria 2786
85 Ga0451576_0129087 3300045051 Bacteria 2635
86 Ga0495608_0064133 3300046511 Bacteria 2409
87 Ga0495640_0173529 3300046533 Bacteria 1377
88 Ga0496102_0101433 3300048905 Bacteria 2674
89 Ga0496104_0000705 3300048907 Bacteria 28693
90 Ga0496105_0001141 3300048908 Bacteria 18529
91 Ga0496108_0001810 3300048911 Bacteria 17053
92 Ga0496108_0233071 3300048911 Bacteria 1601
93 Ga0496109_0167592 3300048912 Bacteria 2060
94 Ga0496110_0075163 3300048913 Bacteria 3001
95 Ga0496111_0003008 3300048914 Bacteria 10322
96 Ga0496113_0001920 3300048916 Bacteria 11881
97 Ga0496114_0173672 3300048917 Bacteria 1879
98 Ga0501046_0030655 3300049580 Bacteria 4364
99 Ga0501075_0034477 3300049591 Bacteria 3769
100 Ga0501076_0049682 3300049592 Bacteria 3318
101 nmdc:mga05p37_257808_c1 3300050507 Bacteria 2089
102 nmdc:mga05p37_4430_c1 3300050507 Bacteria 16410
103 nmdc:mga05p37_527_c1 3300050507 Bacteria 42352
104 nmdc:mga05p37_79728_c1 3300050507 Bacteria 4032
105 nmdc:mga09592_302_c1 3300050508 Bacteria 35907
106 nmdc:mga09592_34655_c1 3300050508 Bacteria 4220
107 nmdc:mga0qj67_3344_c1 3300050509 Bacteria 11553
108 nmdc:mga06r32_105_c1 3300050510 Bacteria 58778
109 nmdc:mga06r32_72308_c1 3300050510 Bacteria 3339
110 nmdc:mga08y16_49705_c1 3300050511 Bacteria 4388
111 Ga0590075_026117 3300059424 Bacteria 1470
112 2644445290 2643221679 Bacteria 3839507
113 Ga0451577_0137703
114 SwRhRL3b_contig_1156335
115 SwRhRL3b_contig_1370232
116 SwRhRL2b_contig_673901
117 JGI25406J46586_10006358
118 Ga0065704_10000250
119 Ga0065704_10002788
120 Ga0065707_10003048
121 Ga0065707_10085611
122 Ga0070683_100101829
123 Ga0070694_100067306
124 Ga0070698_100056688
125 Ga0070699_100009388
126 Ga0070684_100029623
127 Ga0070695_100104977
128 Ga0070702_100034069
129 Ga0068864_100186951
130 Ga0081455_10000128
131 Ga0081455_10004594
132 Ga0081539_10005925
133 Ga0075427_10000024
134 Ga0075428_100004427
135 Ga0075428_100076717
136 Ga0075430_100051341
137 Ga0075430_100068113
138 Ga0075430_100229390
139 Ga0075433_10217642
140 Ga0075429_100008134
141 Ga0075429_100041424
142 Ga0075429_100041947
143 Ga0111539_10007718
144 Ga0111539_10223222
145 Ga0114129_10000238
146 Ga0114129_10004517
147 Ga0114129_10147959
148 Ga0114129_10203721
149 Ga0105243_10108691
150 Ga0105243_10200862
151 Ga0163162_10189659
152 Ga0157380_10113576
153 Ga0207709_10053168
154 Ga0207661_10197720
155 Ga0207428_10001938
156 Ga0268265_10248441
157 Ga0265318_10016597
158 Ga0316575_10013337
159 Ga0316577_10007122
160 Ga0316577_10035800
161 Ga0307413_10079462
162 Ga0316585_10000534
163 Ga0316585_10030014
164 Ga0316582_0013706
165 Ga0316584_0016230
166 Ga0316584_0020035
167 Ga0316584_0028026
168 Ga0316584_0035821
169 Ga0316584_0037600
170 Ga0451577_0050501
171 Ga0451577_0054445
172 Ga0451577_0064242
173 Ga0453683_0002062
174 Ga0453683_0005478
175 Ga0453683_0009903
176 Ga0453683_0045205
177 Ga0453684_0000003
178 Ga0453684_0000564
179 Ga0453684_0008011
180 Ga0453684_0012601
181 Ga0453684_0021735
182 Ga0453684_0032063
183 Ga0453684_0032160
184 Ga0453684_0057589
185 Ga0453684_0059113
186 Ga0453684_0069982
187 Ga0453684_0078098
188 Ga0453684_0166378
189 Ga0453684_0198586
190 Ga0453684_0209624
191 Ga0453684_0259818
192 Ga0453684_0313362
193 Ga0451576_0000189
194 Ga0451576_0008748
195 Ga0451576_0077068
196 Ga0451576_0116157
197 Ga0451576_0129087
198 Ga0495608_0064133
199 Ga0495640_0173529
200 Ga0496102_0101433
201 Ga0496104_0000705
202 Ga0496105_0001141
203 Ga0496108_0001810
204 Ga0496108_0233071
205 Ga0496109_0167592
206 Ga0496110_0075163
207 Ga0496111_0003008
208 Ga0496113_0001920
209 Ga0496114_0173672
210 Ga0501046_0030655
211 Ga0501075_0034477
212 Ga0501076_0049682
213 nmdc:mga05p37_257808_c1
214 nmdc:mga05p37_4430_c1
215 nmdc:mga05p37_527_c1
216 nmdc:mga05p37_79728_c1
217 nmdc:mga09592_302_c1
218 nmdc:mga09592_34655_c1
219 nmdc:mga0qj67_3344_c1
220 nmdc:mga06r32_105_c1
221 nmdc:mga06r32_72308_c1
222 nmdc:mga08y16_49705_c1
223 Ga0590075_026117
224 2644445290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22580

KYNU_C

Kynureninase C-terminal domain

355

445

0.96

PF00266

Aminotran_5

Aminotransferase class-V

76

409

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9662 6 412
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9592 6 412
7s3v-assembly1.cif.gz_A structure of hskynase_66, an evolved variant of human kynureninase with greatly increased activity towards kynurenine 0.919 5 408
2hzp-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase 0.9172 5 408
3e9k-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex 0.917 5 408
ID Description Score Start End Superfamily
1qz9A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.955 310 412 3.90.1150.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9526 45 307 3.40.640.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9455 45 307 3.40.640.10
af_P70712_80_352_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9212 45 308 3.40.640.10
af_Q54Q04_346_448_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9166 306 403 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A6I3DL26-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9826 190 405 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7W0PD12-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9814 188 409 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A388NZS2-F1-model_v4 Kynureninase 0.9798 206 414 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7C7HW69-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9783 20 365 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A3C1JG16-F1-model_v4 deleted 0.9748 10 422

Map