F071858

General Info

Members Datasets Scaffolds Average Seq Length
113 83 110 225

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10203510|rootH1_102035102
Length 261
Sequence VPHQTVLKEAIVSKFLKLIKSPLGFLNAMKKQIKDMKTYMVILPLSSATILVSLPTGADAQFVVGSVISSTVGRAIRAIDLEVQRLQNRTIWLQDAQKTVENQLSRLKLAEISDQTQKQEKLFENYYQELQTVKSVIEYYGRIKEMTEKQASLVSQYNHAWNLLRSDKHFSTDELNYMQKVYSGILQESVRNLDEILVVINSFKTQMTDAKRLEIINKAADRVDTNSSDLKQFNNQNYILSIQRAQSENEIKTLKEYYGID

Samples

Sample ID Description Type Environment
1 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
64 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
67 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
73 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
74 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
79 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
80 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
81 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
82 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
83 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.62
Nodule 0
Rhizoplane 0
Rhizosphere 72.57
Stem 0
Stem Tuber 0
Unclassified 16.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005868 3300001904 Bacteria 2075
2 JGI24740J21852_10004785 3300001979 Bacteria 5775
3 JGI24739J22299_10001500 3300001989 Bacteria 8815
4 JGI24739J22299_10033007 3300001989 Unclassified 1776
5 JGI24737J22298_10003187 3300001990 Bacteria 5819
6 JGI24735J21928_10000005 3300002067 Bacteria 356755
7 JGI25162J39368_1000672 3300002737 Bacteria 24058
8 JGI25157J39369_1006364 3300002741 Bacteria 1806
9 rootH1_10117976 3300003316 Unclassified 1393
10 rootH1_10148167 3300003316 Bacteria 2691
11 rootH1_10189365 3300003316 Bacteria 1856
12 rootH2_10089202 3300003320 Bacteria 9046
13 rootL2_10249103 3300003322 Bacteria 2662
14 rootH1_10134299 3300003323 Bacteria 3114
15 rootH1_10177398 3300003323 Bacteria 5633
16 rootH1_10203510 3300003323 Bacteria 3307
17 rootH1_10263524 3300003323 Bacteria 3770
18 Ga0055531_10000077 3300003794 Bacteria 106111
19 Ga0055531_10021608 3300003794 Bacteria 2489
20 Ga0065714_10065794 3300005288 Bacteria 8488
21 Ga0065712_10021259 3300005290 Bacteria 1272
22 Ga0070658_10186487 3300005327 Bacteria 1747
23 Ga0070658_10654699 3300005327 Bacteria 911
24 Ga0070683_100008526 3300005329 Bacteria 8711
25 Ga0070670_100439986 3300005331 Bacteria 1154
26 Ga0070659_100000403 3300005366 Bacteria 32763
27 Ga0070659_100021580 3300005366 Bacteria 4907
28 Ga0068855_100118963 3300005563 Bacteria 3025
29 Ga0068864_100378243 3300005618 Unclassified 1341
30 Ga0068870_10073000 3300005840 Bacteria 1876
31 Ga0068863_100000100 3300005841 Bacteria 94010
32 Ga0068862_100699064 3300005844 Bacteria 982
33 Ga0097621_100000235 3300006237 Bacteria 37163
34 Ga0068871_100263493 3300006358 Bacteria 1504
35 Ga0068871_100382558 3300006358 Bacteria 1250
36 Ga0105240_10213036 3300009093 Bacteria 2256
37 Ga0105240_10326495 3300009093 Bacteria 1747
38 Ga0105245_10375200 3300009098 Unclassified 1415
39 Ga0105237_10000496 3300009545 Bacteria 55702
40 Ga0105237_10001541 3300009545 Bacteria 30097
41 Ga0105237_10150091 3300009545 Bacteria 2327
42 Ga0105237_10258498 3300009545 Bacteria 1744
43 Ga0105239_10310922 3300010375 Bacteria 1776
44 Ga0157373_10000299 3300013100 Bacteria 40111
45 Ga0157371_10000192 3300013102 Bacteria 90362
46 Ga0157370_10000050 3300013104 Bacteria 123492
47 Ga0157369_10000742 3300013105 Bacteria 42082
48 Ga0157369_10004846 3300013105 Bacteria 15792
49 Ga0157369_10229714 3300013105 Unclassified 1940
50 Ga0157378_10099197 3300013297 Viruses 2657
51 Ga0163162_10000229 3300013306 Bacteria 51289
52 Ga0163162_10008725 3300013306 Bacteria 9864
53 Ga0163162_10106145 3300013306 Unclassified 2904
54 Ga0157372_10000326 3300013307 Bacteria 52158
55 Ga0157372_10006685 3300013307 Bacteria 12266
56 Ga0157372_10049700 3300013307 Bacteria 4664
57 Ga0157372_10203462 3300013307 Bacteria 2294
58 Ga0209437_100024 3300025233 Bacteria 592878
59 Ga0209026_1000912 3300025250 Bacteria 15143
60 Ga0209026_1002947 3300025250 Bacteria 5937
61 Ga0209148_1028145 3300025254 Bacteria 858
62 Ga0209233_1007727 3300025261 Bacteria 3381
63 Ga0209233_1031873 3300025261 Unclassified 1226
64 Ga0209050_1000125 3300025298 Bacteria 189641
65 Ga0209257_1000007 3300025304 Bacteria 1564415
66 Ga0209257_1000994 3300025304 Bacteria 38435
67 Ga0207647_10000120 3300025904 Bacteria 61491
68 Ga0207643_10182329 3300025908 Unclassified 1271
69 Ga0207671_10084533 3300025914 Bacteria 2383
70 Ga0207690_10000218 3300025932 Bacteria 43701
71 Ga0207690_10023190 3300025932 Bacteria 3872
72 Ga0207686_10124520 3300025934 Unclassified 1759
73 Ga0207667_10096932 3300025949 Bacteria 3044
74 Ga0207712_10763168 3300025961 Bacteria 848
75 Ga0207641_10000013 3300026088 Bacteria 341378
76 Ga0207676_10003410 3300026095 Bacteria 11238
77 Ga0307515_10000114 3300028794 Bacteria 194024
78 Ga0307408_100350688 3300031548 Bacteria 1252
79 Ga0307413_10150278 3300031824 Bacteria 1622
80 Ga0307406_10669190 3300031901 Bacteria 864
81 Ga0307412_10018099 3300031911 Bacteria 4231
82 Ga0307507_10001179 3300033179 Bacteria 58154
83 Ga0395899_0000002 3300037312 Bacteria 1324310
84 Ga0395899_0000033 3300037312 Bacteria 306589
85 Ga0395901_0969243 3300038443 Bacteria 828
86 Ga0495650_0000013 3300046471 Bacteria 611135
87 Ga0495585_0000041 3300046492 Bacteria 126995
88 Ga0495606_0027784 3300046507 Bacteria 4004
89 Ga0495610_0127104 3300046512 Bacteria 1110
90 Ga0495637_0016796 3300046520 Bacteria 3419
91 Ga0495643_0046411 3300046522 Unclassified 2355
92 Ga0495648_0001150 3300046524 Bacteria 26778
93 Ga0495648_0001429 3300046524 Bacteria 23367
94 Ga0495648_0008376 3300046524 Bacteria 8148
95 Ga0495668_0258658 3300046616 Bacteria 953
96 Ga0495625_0018167 3300046660 Bacteria 5496
97 Ga0495625_0044995 3300046660 Bacteria 3193
98 Ga0495661_0001723 3300046665 Bacteria 17703
99 Ga0495660_0033917 3300046810 Bacteria 2859
100 Ga0495686_0002849 3300047472 Bacteria 15585
101 Ga0495686_0111088 3300047472 Bacteria 1644
102 Ga0496122_0005678 3300048925 Bacteria 14728
103 Ga0496123_0028316 3300048926 Bacteria 4151
104 Ga0496125_0067221 3300048928 Bacteria 2826
105 Ga0495678_010494 3300049459 Bacteria 4501
106 Ga0501297_017745 3300049520 Bacteria 869
107 Ga0501206_004218 3300049653 Bacteria 1825
108 Ga0501257_046945 3300049686 Bacteria 1070
109 Ga0500635_0029909 3300053080 Bacteria 1752
110 Ga0500608_037504 3300053122 Unclassified 2316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10189365 rootH1_101893652 185
2 3300046522 Ga0495643_0046411 Ga0495643_0046411_250_882 194
3 3300005563 Ga0068855_100118963 Ga0068855_1001189633 196
4 3300025949 Ga0207667_10096932 Ga0207667_100969323 196
5 3300037312 Ga0395899_0000002 Ga0395899_0000002_1206049_1206729 197
6 3300003323 rootH1_10134299 rootH1_101342993 198
7 3300009545 Ga0105237_10001541 Ga0105237_1000154118 199
8 3300001989 JGI24739J22299_10033007 JGI24739J22299_100330073 200
9 3300001990 JGI24737J22298_10003187 JGI24737J22298_100031876 200
10 3300002067 JGI24735J21928_10000005 JGI24735J21928_10000005289 200
11 3300009545 Ga0105237_10000496 Ga0105237_1000049615 200
12 3300013307 Ga0157372_10000326 Ga0157372_1000032624 200
13 3300013104 Ga0157370_10000050 Ga0157370_1000005086 202
14 3300013297 Ga0157378_10099197 Ga0157378_100991973 202
15 3300048925 Ga0496122_0005678 Ga0496122_0005678_9655_10326 202
16 3300048926 Ga0496123_0028316 Ga0496123_0028316_928_1599 202
17 3300048928 Ga0496125_0067221 Ga0496125_0067221_824_1495 202
18 3300025250 Ga0209026_1002947 Ga0209026_10029477 203
19 3300025261 Ga0209233_1031873 Ga0209233_10318732 203
20 3300003794 Ga0055531_10000077 Ga0055531_1000007741 204
21 3300005327 Ga0070658_10186487 Ga0070658_101864873 204
22 3300005327 Ga0070658_10654699 Ga0070658_106546992 204
23 3300005366 Ga0070659_100000403 Ga0070659_10000040318 204
24 3300009093 Ga0105240_10213036 Ga0105240_102130362 204
25 3300013306 Ga0163162_10106145 Ga0163162_101061453 204
26 3300025261 Ga0209233_1007727 Ga0209233_10077274 204
27 3300025304 Ga0209257_1000007 Ga0209257_1000007642 204
28 3300025932 Ga0207690_10000218 Ga0207690_1000021820 204
29 3300028794 Ga0307515_10000114 Ga0307515_1000011439 206
30 3300033179 Ga0307507_10001179 Ga0307507_1000117922 206
31 3300046471 Ga0495650_0000013 Ga0495650_0000013_184598_185266 206
32 3300049459 Ga0495678_010494 Ga0495678_010494_3110_3778 206
33 iso_pu_bacteria 2884791551 2884791718 206
34 3300001989 JGI24739J22299_10001500 JGI24739J22299_100015007 207
35 3300002737 JGI25162J39368_1000672 JGI25162J39368_100067216 207
36 3300005329 Ga0070683_100008526 Ga0070683_1000085264 207
37 3300006237 Ga0097621_100000235 Ga0097621_10000023530 207
38 3300013105 Ga0157369_10229714 Ga0157369_102297143 207
39 3300025233 Ga0209437_100024 Ga0209437_10002414 207
40 3300025250 Ga0209026_1000912 Ga0209026_100091213 207
41 iso_pu_bacteria 2919437846 2919439067 207
42 3300005290 Ga0065712_10021259 Ga0065712_100212591 208
43 3300005618 Ga0068864_100378243 Ga0068864_1003782432 208
44 3300005844 Ga0068862_100699064 Ga0068862_1006990641 208
45 3300006358 Ga0068871_100263493 Ga0068871_1002634932 208
46 3300010375 Ga0105239_10310922 Ga0105239_103109222 208
47 3300013306 Ga0163162_10008725 Ga0163162_100087255 208
48 3300025934 Ga0207686_10124520 Ga0207686_101245202 208
49 3300025961 Ga0207712_10763168 Ga0207712_107631681 208
50 3300026095 Ga0207676_10003410 Ga0207676_1000341012 208
51 3300046660 Ga0495625_0044995 Ga0495625_0044995_1896_2588 208
52 3300047472 Ga0495686_0002849 Ga0495686_0002849_4817_5491 208
53 3300047472 Ga0495686_0111088 Ga0495686_0111088_631_1353 208
54 3300003794 Ga0055531_10021608 Ga0055531_100216082 209
55 3300005331 Ga0070670_100439986 Ga0070670_1004399862 209
56 3300005841 Ga0068863_100000100 Ga0068863_10000010013 209
57 3300025298 Ga0209050_1000125 Ga0209050_100012588 209
58 3300025304 Ga0209257_1000994 Ga0209257_100099414 209
59 3300026088 Ga0207641_10000013 Ga0207641_10000013164 209
60 3300003316 rootH1_10148167 rootH1_101481674 210
61 3300046660 Ga0495625_0018167 Ga0495625_0018167_2105_2797 210
62 iso_pu_bacteria 2928147474 2928148232 210
63 3300001979 JGI24740J21852_10004785 JGI24740J21852_100047855 211
64 3300003322 rootL2_10249103 rootL2_102491033 211
65 3300005288 Ga0065714_10065794 Ga0065714_100657949 211
66 3300005366 Ga0070659_100021580 Ga0070659_1000215802 211
67 3300009545 Ga0105237_10150091 Ga0105237_101500912 211
68 3300009545 Ga0105237_10258498 Ga0105237_102584981 211
69 3300013100 Ga0157373_10000299 Ga0157373_1000029936 211
70 3300013306 Ga0163162_10000229 Ga0163162_1000022921 211
71 3300013307 Ga0157372_10049700 Ga0157372_100497002 211
72 3300025254 Ga0209148_1028145 Ga0209148_10281451 211
73 3300025904 Ga0207647_10000120 Ga0207647_1000012028 211
74 3300025914 Ga0207671_10084533 Ga0207671_100845332 211
75 3300025932 Ga0207690_10023190 Ga0207690_100231903 211
76 3300031548 Ga0307408_100350688 Ga0307408_1003506882 211
77 3300031824 Ga0307413_10150278 Ga0307413_101502782 211
78 3300031901 Ga0307406_10669190 Ga0307406_106691901 211
79 3300031911 Ga0307412_10018099 Ga0307412_100180996 211
80 3300037312 Ga0395899_0000033 Ga0395899_0000033_106791_107471 211
81 3300046492 Ga0495585_0000041 Ga0495585_0000041_88893_89573 211
82 3300046512 Ga0495610_0127104 Ga0495610_0127104_205_891 211
83 3300046520 Ga0495637_0016796 Ga0495637_0016796_1525_2205 211
84 3300046524 Ga0495648_0001429 Ga0495648_0001429_19688_20368 211
85 3300046524 Ga0495648_0008376 Ga0495648_0008376_5915_6595 211
86 3300046616 Ga0495668_0258658 Ga0495668_0258658_120_806 211
87 3300046665 Ga0495661_0001723 Ga0495661_0001723_9511_10197 211
88 3300046810 Ga0495660_0033917 Ga0495660_0033917_426_1109 211
89 3300049520 Ga0501297_017745 Ga0501297_017745_126_815 211
90 3300049653 Ga0501206_004218 Ga0501206_004218_991_1680 211
91 3300049686 Ga0501257_046945 Ga0501257_046945_90_779 211
92 3300013102 Ga0157371_10000192 Ga0157371_1000019264 212
93 3300003316 rootH1_10117976 rootH1_101179762 213
94 3300053122 Ga0500608_037504 Ga0500608_037504_416_1108 214
95 3300003323 rootH1_10263524 rootH1_102635243 218
96 3300006358 Ga0068871_100382558 Ga0068871_1003825582 218
97 3300009098 Ga0105245_10375200 Ga0105245_103752002 218
98 3300002741 JGI25157J39369_1006364 JGI25157J39369_10063641 219
99 3300003323 rootH1_10177398 rootH1_101773984 219
100 3300009093 Ga0105240_10326495 Ga0105240_103264952 219
101 3300013307 Ga0157372_10203462 Ga0157372_102034622 219
102 3300046524 Ga0495648_0001150 Ga0495648_0001150_23043_23747 219
103 3300046507 Ga0495606_0027784 Ga0495606_0027784_1404_2117 221
104 3300053080 Ga0500635_0029909 Ga0500635_0029909_150_869 223
105 3300005840 Ga0068870_10073000 Ga0068870_100730002 224
106 3300025908 Ga0207643_10182329 Ga0207643_101823291 224
107 3300001904 JGI24736J21556_1005868 JGI24736J21556_10058682 227
108 3300003320 rootH2_10089202 rootH2_100892022 227
109 3300003323 rootH1_10203510 rootH1_102035102 227
110 3300013105 Ga0157369_10000742 Ga0157369_1000074226 227
111 3300013105 Ga0157369_10004846 Ga0157369_1000484612 227
112 3300013307 Ga0157372_10006685 Ga0157372_100066853 227
113 3300038443 Ga0395901_0969243 Ga0395901_0969243_65_793 227

Feature Viewer

pLDDT pTM Quality
56.99 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map