F074208

General Info

Members Datasets Scaffolds Average Seq Length
113 88 218 312

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10208462|Ga0207663_102084622
Length 354
Sequence MSSWHKECGDCCACCRFTHRKTPQTSFERTGVGKTSQRSGKDRKRDPEPMERAGFQHQALIYEGDDEYLAGTVPFLRDALEAGEPTLVSVGAAQAVLLEGELGRDARGIRFLNMEEAGRNPAWIIPLWREFVDENGGRAVRGVGEPVWTGRSPAALDECQRHESLLNVAFAPGTPWSLLCPYDAGSLEEDVLENVAVSHRHVHRVGHSEESAAFEAERDCFAGELPLPGAEPEAVPFGLAGLSAVRHRVASAAERAGMGPVEVDDLVTATSELAANSVMHGGGSGMLRLWREEGRLLIEVEDRGRIEEPLVGRLRPGIAQEGGRGLWLANQLCNLVQIRSGEAGTTIRLHFSCA

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
87 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
88 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 1.77
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.08
Rhizosphere 92.04
Stem 0
Stem Tuber 0
Unclassified 6.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10208462 3300025916 Unclassified 1415
2 rootH2_10002729 3300003320 Unclassified 2806
3 Ga0070683_100010013 3300005329 Bacteria 8131
4 Ga0070670_100377720 3300005331 Unclassified 1248
5 Ga0070682_100000026 3300005337 Bacteria 191388
6 Ga0068868_100001709 3300005338 Bacteria 15018
7 Ga0070673_100031027 3300005364 Bacteria 4007
8 Ga0070688_100000271 3300005365 Bacteria 26844
9 Ga0070659_100010697 3300005366 Bacteria 6760
10 Ga0070659_100022157 3300005366 Bacteria 4847
11 Ga0070713_100000005 3300005436 Bacteria 201526
12 Ga0070711_100005411 3300005439 Bacteria 7632
13 Ga0070711_100248867 3300005439 Unclassified 1393
14 Ga0070663_100134210 3300005455 Bacteria 1883
15 Ga0068867_100000179 3300005459 Bacteria 41694
16 Ga0070685_10000012 3300005466 Bacteria 128823
17 Ga0070685_10000627 3300005466 Bacteria 19323
18 Ga0070684_100003218 3300005535 Bacteria 12217
19 Ga0068853_100308799 3300005539 Bacteria 1463
20 Ga0068857_100181179 3300005577 Bacteria 1917
21 Ga0068854_100000062 3300005578 Bacteria 78159
22 Ga0068856_100004990 3300005614 Bacteria 13143
23 Ga0068852_100000022 3300005616 Bacteria 125196
24 Ga0068851_10000933 3300005834 Bacteria 12643
25 Ga0070715_10047894 3300006163 Bacteria 1824
26 Ga0070712_100003550 3300006175 Bacteria 9603
27 Ga0075428_100002112 3300006844 Bacteria 21440
28 Ga0075430_100005839 3300006846 Bacteria 10388
29 Ga0075431_100035572 3300006847 Bacteria 5128
30 Ga0075429_100001520 3300006880 Bacteria 19083
31 Ga0068865_100000061 3300006881 Bacteria 57211
32 Ga0105245_10000023 3300009098 Bacteria 180844
33 Ga0105245_10002542 3300009098 Bacteria 16442
34 Ga0114129_10007455 3300009147 Bacteria 15584
35 Ga0105248_10000245 3300009177 Bacteria 62951
36 Ga0105239_10020042 3300010375 Bacteria 7379
37 Ga0157371_10001441 3300013102 Bacteria 24694
38 Ga0157370_10115540 3300013104 Bacteria 2507
39 Ga0157370_10125408 3300013104 Bacteria 2397
40 Ga0157369_10000014 3300013105 Bacteria 266411
41 Ga0157372_10001763 3300013307 Bacteria 23465
42 Ga0157379_10131914 3300014968 Bacteria 2249
43 Ga0157376_10035191 3300014969 Bacteria 4050
44 Ga0206354_10819528 3300020081 Bacteria 3111
45 Ga0206353_10937207 3300020082 Bacteria 3867
46 Ga0207656_10000111 3300025321 Bacteria 31159
47 Ga0207693_10000955 3300025915 Bacteria 25933
48 Ga0207649_10000003 3300025920 Bacteria 388908
49 Ga0207687_10000015 3300025927 Bacteria 261701
50 Ga0207687_10002068 3300025927 Bacteria 13737
51 Ga0207700_10000003 3300025928 Bacteria 500797
52 Ga0207664_10014785 3300025929 Bacteria 5650
53 Ga0207690_10011149 3300025932 Bacteria 5364
54 Ga0207670_10126437 3300025936 Unclassified 1866
55 Ga0207704_10000026 3300025938 Bacteria 123892
56 Ga0207711_10000192 3300025941 Bacteria 65599
57 Ga0207661_10002070 3300025944 Bacteria 13792
58 Ga0207651_10020226 3300025960 Bacteria 4012
59 Ga0207640_10000074 3300025981 Bacteria 78164
60 Ga0207677_10001055 3300026023 Bacteria 15110
61 Ga0207639_10254214 3300026041 Bacteria 1534
62 Ga0207702_10004785 3300026078 Bacteria 11930
63 Ga0207648_10000228 3300026089 Bacteria 60032
64 Ga0207674_10201260 3300026116 Bacteria 1941
65 Ga0207683_10004476 3300026121 Bacteria 12064
66 Ga0207698_10000043 3300026142 Bacteria 96553
67 Ga0268266_10078906 3300028379 Bacteria 2866
68 Ga0466972_0004994 3300044658 Bacteria 6652
69 Ga0466965_0003704 3300044683 Bacteria 6749
70 Ga0466960_0000272 3300044901 Bacteria 17893
71 Ga0495592_0193267 3300046454 Bacteria 1378
72 Ga0495582_0000005 3300046473 Bacteria 156170
73 Ga0495608_0000035 3300046511 Bacteria 133011
74 Ga0495608_0000146 3300046511 Bacteria 51037
75 Ga0495587_0031264 3300046536 Bacteria 3224
76 Ga0495657_0000003 3300046675 Bacteria 279680
77 Ga0495657_0000026 3300046675 Bacteria 133011
78 Ga0495658_0000019 3300046683 Bacteria 91606
79 Ga0495658_0004630 3300046683 Bacteria 6764
80 Ga0495613_0000027 3300046689 Bacteria 146674
81 Ga0495624_0000028 3300046690 Bacteria 93474
82 Ga0495600_0022700 3300046809 Unclassified 4032
83 Ga0495604_0000058 3300047317 Bacteria 96955
84 Ga0495604_0000293 3300047317 Bacteria 44767
85 Ga0495604_0004857 3300047317 Bacteria 10648
86 Ga0495604_0013478 3300047317 Bacteria 6513
87 Ga0495675_0000002 3300047444 Bacteria 216469
88 Ga0495675_0000015 3300047444 Bacteria 133004
89 Ga0495602_0000393 3300048088 Bacteria 40803
90 Ga0495602_0117155 3300048088 Unclassified 2151
91 Ga0496104_0018264 3300048907 Bacteria 6398
92 Ga0496104_0162131 3300048907 Bacteria 2144
93 Ga0496108_0000005 3300048911 Bacteria 535059
94 Ga0496109_0000002 3300048912 Bacteria 443393
95 Ga0496110_0000235 3300048913 Bacteria 35772
96 Ga0496111_0000011 3300048914 Bacteria 88409
97 Ga0496112_0041734 3300048915 Bacteria 4489
98 Ga0496113_0000001 3300048916 Bacteria 224977
99 nmdc:mga06r32_149013_c1 3300050510 Bacteria 2318
100 Ga0495601_0000017 3300053077 Bacteria 204209
101 Ga0495595_0000017 3300053084 Bacteria 133011
102 Ga0495595_0000068 3300053084 Bacteria 51063
103 Ga0495595_0001427 3300053084 Bacteria 9293
104 Ga0495595_0004603 3300053084 Bacteria 5547
105 Ga0495619_0000054 3300053085 Bacteria 97928
106 Ga0495619_0000101 3300053085 Bacteria 64377
107 Ga0495619_0000153 3300053085 Bacteria 51013
108 Ga0495619_0005593 3300053085 Bacteria 7973
109 8056448963 8056447290 Bacteria 7680491
110 Ga0207663_10208462
111 rootH2_10002729
112 Ga0070683_100010013
113 Ga0070670_100377720
114 Ga0070682_100000026
115 Ga0068868_100001709
116 Ga0070673_100031027
117 Ga0070688_100000271
118 Ga0070659_100010697
119 Ga0070659_100022157
120 Ga0070713_100000005
121 Ga0070711_100005411
122 Ga0070711_100248867
123 Ga0070663_100134210
124 Ga0068867_100000179
125 Ga0070685_10000012
126 Ga0070685_10000627
127 Ga0070684_100003218
128 Ga0068853_100308799
129 Ga0068857_100181179
130 Ga0068854_100000062
131 Ga0068856_100004990
132 Ga0068852_100000022
133 Ga0068851_10000933
134 Ga0070715_10047894
135 Ga0070712_100003550
136 Ga0075428_100002112
137 Ga0075430_100005839
138 Ga0075431_100035572
139 Ga0075429_100001520
140 Ga0068865_100000061
141 Ga0105245_10000023
142 Ga0105245_10002542
143 Ga0114129_10007455
144 Ga0105248_10000245
145 Ga0105239_10020042
146 Ga0157371_10001441
147 Ga0157370_10115540
148 Ga0157370_10125408
149 Ga0157369_10000014
150 Ga0157372_10001763
151 Ga0157379_10131914
152 Ga0157376_10035191
153 Ga0206354_10819528
154 Ga0206353_10937207
155 Ga0207656_10000111
156 Ga0207693_10000955
157 Ga0207649_10000003
158 Ga0207687_10000015
159 Ga0207687_10002068
160 Ga0207700_10000003
161 Ga0207664_10014785
162 Ga0207690_10011149
163 Ga0207670_10126437
164 Ga0207704_10000026
165 Ga0207711_10000192
166 Ga0207661_10002070
167 Ga0207651_10020226
168 Ga0207640_10000074
169 Ga0207677_10001055
170 Ga0207639_10254214
171 Ga0207702_10004785
172 Ga0207648_10000228
173 Ga0207674_10201260
174 Ga0207683_10004476
175 Ga0207698_10000043
176 Ga0268266_10078906
177 Ga0466972_0004994
178 Ga0466965_0003704
179 Ga0466960_0000272
180 Ga0495592_0193267
181 Ga0495582_0000005
182 Ga0495608_0000035
183 Ga0495608_0000146
184 Ga0495587_0031264
185 Ga0495657_0000003
186 Ga0495657_0000026
187 Ga0495658_0000019
188 Ga0495658_0004630
189 Ga0495613_0000027
190 Ga0495624_0000028
191 Ga0495600_0022700
192 Ga0495604_0000058
193 Ga0495604_0000293
194 Ga0495604_0004857
195 Ga0495604_0013478
196 Ga0495675_0000002
197 Ga0495675_0000015
198 Ga0495602_0000393
199 Ga0495602_0117155
200 Ga0496104_0018264
201 Ga0496104_0162131
202 Ga0496108_0000005
203 Ga0496109_0000002
204 Ga0496110_0000235
205 Ga0496111_0000011
206 Ga0496112_0041734
207 Ga0496113_0000001
208 nmdc:mga06r32_149013_c1
209 Ga0495601_0000017
210 Ga0495595_0000017
211 Ga0495595_0000068
212 Ga0495595_0001427
213 Ga0495595_0004603
214 Ga0495619_0000054
215 Ga0495619_0000101
216 Ga0495619_0000153
217 Ga0495619_0005593
218 8056448963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14417

MEDS

MEDS: MEthanogen/methylotroph, DcmR Sensory domain

56

200

0.97

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

235

351

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8951 184 303
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8782 184 303
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8569 181 302
1th8-assembly1.cif.gz_A-2 crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.8526 182 303
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8495 184 305
ID Description Score Start End Superfamily
af_P37366_98_210_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8598 189 230 1.10.472.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8217 185 301 3.30.565.10
af_P0AEC8_402_541_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.801 210 307 3.30.565.10
3ke6B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.792 176 307 3.30.565.10
af_Q2FWJ3_5_155_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7844 181 306 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A6G4BEA6-F1-model_v4 deleted 0.9778 6 150
AF-A0A132MZB9-F1-model_v4 Putative anti-sigma regulatory factor 0.9748 1 306 GO:0004674
AF-A0A7W0Y0B3-F1-model_v4 MEDS domain-containing protein 0.9719 5 243
AF-A0A852WIB7-F1-model_v4 Anti-sigma regulatory factor (Ser/Thr protein kinase) 0.9712 1 303 GO:0004674
AF-A0A0Q9LTV4-F1-model_v4 Anti-sigma regulatory factor 0.9707 1 307 GO:0004674

Map