F076674

General Info

Members Datasets Scaffolds Average Seq Length
114 64 114 122

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10016165|rootH2_100161651
Length 124
Sequence MDFLRLTTVARQVVAAAQKRLPPDVRAAAETVPVCYEPFPNDAIQEEGWEPDILGLFVGHEHGGELRDDSVPLPPQILLFLENLWDYAEGDETLYRDEVRLTYLHELGHYLGWDEDEIARRGLE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
13 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
14 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
15 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
20 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
21 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
22 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
23 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
24 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
25 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
28 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
29 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
30 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
56 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
57 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
58 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
59 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
60 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
61 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
62 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
63 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
64 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 0
Rhizosphere 91.23
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016165 3300003320 Bacteria 8851
2 rootL2_10054276 3300003322 Bacteria 5431
3 rootL2_10188220 3300003322 Bacteria 1654
4 Ga0070675_101971769 3300005354 Unclassified 538
5 Ga0070711_100425840 3300005439 Bacteria 1082
6 Ga0068853_100098153 3300005539 Bacteria 2587
7 Ga0070665_100000027 3300005548 Bacteria 359314
8 Ga0068855_101757248 3300005563 Unclassified 631
9 Ga0068856_100016990 3300005614 Bacteria 7053
10 Ga0068852_100562798 3300005616 Bacteria 1141
11 Ga0068858_100001790 3300005842 Bacteria 21918
12 Ga0068858_100339159 3300005842 Unclassified 1438
13 Ga0068858_101457723 3300005842 Bacteria 675
14 Ga0105240_10261108 3300009093 Unclassified 1998
15 Ga0157370_11702411 3300013104 Bacteria 566
16 Ga0157375_11440397 3300013308 Bacteria 812
17 Ga0157377_11711528 3300014745 Bacteria 508
18 Ga0207663_10289069 3300025916 Bacteria 1220
19 Ga0207677_11101966 3300026023 Bacteria 724
20 Ga0207703_10001370 3300026035 Bacteria 22258
21 Ga0207702_10304670 3300026078 Bacteria 1513
22 Ga0265337_1011773 3300028556 Bacteria 3001
23 Ga0265337_1037907 3300028556 Bacteria 1400
24 Ga0265319_1001493 3300028563 Bacteria 13940
25 Ga0265319_1002805 3300028563 Bacteria 9336
26 Ga0265319_1006493 3300028563 Bacteria 5410
27 Ga0265319_1009628 3300028563 Bacteria 4097
28 Ga0265319_1010462 3300028563 Bacteria 3867
29 Ga0265319_1080812 3300028563 Unclassified 1032
30 Ga0265334_10003350 3300028573 Bacteria 7313
31 Ga0265334_10127049 3300028573 Bacteria 909
32 Ga0265318_10000038 3300028577 Bacteria 136367
33 Ga0265318_10001330 3300028577 Bacteria 14800
34 Ga0265318_10002375 3300028577 Bacteria 10095
35 Ga0265318_10003955 3300028577 Bacteria 7304
36 Ga0265318_10024520 3300028577 Bacteria 2391
37 Ga0265318_10032357 3300028577 Bacteria 2024
38 Ga0265318_10091116 3300028577 Bacteria 1123
39 Ga0265323_10015002 3300028653 Unclassified 3053
40 Ga0265322_10005195 3300028654 Bacteria 3852
41 Ga0265336_10000665 3300028666 Bacteria 18644
42 Ga0307515_10075945 3300028794 Bacteria 4467
43 Ga0265338_10005448 3300028800 Bacteria 16611
44 Ga0265324_10001940 3300029957 Bacteria 11088
45 Ga0265324_10087666 3300029957 Bacteria 1058
46 Ga0265332_10057328 3300031238 Unclassified 1669
47 Ga0265332_10088307 3300031238 Unclassified 1312
48 Ga0265332_10126695 3300031238 Bacteria 1072
49 Ga0265332_10295028 3300031238 Bacteria 669
50 Ga0265328_10005553 3300031239 Bacteria 5396
51 Ga0265320_10000431 3300031240 Bacteria 33083
52 Ga0265320_10001948 3300031240 Bacteria 14570
53 Ga0265320_10003933 3300031240 Bacteria 9812
54 Ga0265320_10006534 3300031240 Bacteria 7340
55 Ga0265320_10006980 3300031240 Bacteria 7045
56 Ga0265320_10037923 3300031240 Unclassified 2423
57 Ga0265320_10072998 3300031240 Unclassified 1613
58 Ga0265320_10095201 3300031240 Bacteria 1376
59 Ga0265325_10041898 3300031241 Bacteria 2397
60 Ga0265325_10062273 3300031241 Bacteria 1890
61 Ga0265329_10183980 3300031242 Bacteria 684
62 Ga0265340_10018027 3300031247 Bacteria 3649
63 Ga0265340_10121628 3300031247 Bacteria 1201
64 Ga0265339_10094488 3300031249 Bacteria 1563
65 Ga0265331_10002824 3300031250 Bacteria 11514
66 Ga0265331_10069214 3300031250 Bacteria 1653
67 Ga0265331_10335439 3300031250 Bacteria 677
68 Ga0265327_10000029 3300031251 Bacteria 352607
69 Ga0265327_10002468 3300031251 Bacteria 19466
70 Ga0265316_10001324 3300031344 Bacteria 26657
71 Ga0265316_10043409 3300031344 Bacteria 3584
72 Ga0265316_10264413 3300031344 Bacteria 1260
73 Ga0265316_11226530 3300031344 Unclassified 519
74 Ga0307513_10426119 3300031456 Unclassified 1056
75 Ga0265313_10003948 3300031595 Bacteria 11667
76 Ga0265313_10010967 3300031595 Bacteria 5671
77 Ga0265313_10227373 3300031595 Bacteria 767
78 Ga0265314_10000432 3300031711 Bacteria 56071
79 Ga0265314_10007380 3300031711 Bacteria 9541
80 Ga0265314_10031122 3300031711 Bacteria 3943
81 Ga0265314_10205050 3300031711 Bacteria 1162
82 Ga0265342_10024622 3300031712 Bacteria 3798
83 Ga0265342_10027012 3300031712 Unclassified 3593
84 Ga0265342_10249136 3300031712 Bacteria 948
85 Ga0307413_10266623 3300031824 Bacteria 1280
86 Ga0307410_10794948 3300031852 Bacteria 804
87 Ga0373927_0205316 3300035695 Bacteria 1294
88 Ga0395905_1262900 3300037471 Bacteria 642
89 Ga0451853_1215770 3300041512 Bacteria 634
90 Ga0439441_009780 3300042001 Bacteria 1596
91 Ga0451577_0000023 3300042876 Bacteria 419051
92 Ga0451577_0048373 3300042876 Unclassified 3799
93 Ga0451577_0051889 3300042876 Unclassified 3662
94 Ga0451577_0929261 3300042876 Unclassified 783
95 Ga0453684_0000019 3300044712 Bacteria 908702
96 Ga0453684_0099878 3300044712 Bacteria 3553
97 Ga0453684_0908383 3300044712 Unclassified 942
98 Ga0453684_1281734 3300044712 Unclassified 765
99 Ga0451576_0068003 3300045051 Bacteria 3708
100 Ga0501034_0065425 3300049571 Bacteria 3648
101 Ga0501046_0035823 3300049580 Bacteria 3997
102 Ga0501047_0032051 3300049581 Bacteria 5071
103 Ga0501071_0979124 3300049587 Unclassified 653
104 Ga0501199_022966 3300049650 Bacteria 733
105 Ga0501257_252688 3300049686 Bacteria 523
106 Ga0501080_0734419 3300049742 Bacteria 869
107 Ga0501083_0002522 3300049744 Bacteria 12573
108 Ga0501083_0088432 3300049744 Bacteria 2048
109 Ga0501083_0161680 3300049744 Bacteria 1465
110 Ga0501035_0008606 3300049822 Bacteria 9496
111 Ga0500556_0275079 3300053104 Unclassified 661
112 Ga0500573_0471054 3300053140 Bacteria 575
113 Ga0500588_0068626 3300053146 Bacteria 1156
114 Ga0500622_0012059 3300053156 Bacteria 4696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0979124 Ga0501071_0979124_326_637 103
2 3300044712 Ga0453684_1281734 Ga0453684_1281734_115_486 104
3 3300053146 Ga0500588_0068626 Ga0500588_0068626_216_590 108
4 3300031240 Ga0265320_10003933 Ga0265320_100039338 109
5 3300031241 Ga0265325_10062273 Ga0265325_100622733 109
6 3300031595 Ga0265313_10010967 Ga0265313_100109674 109
7 3300031711 Ga0265314_10000432 Ga0265314_100004324 109
8 3300005548 Ga0070665_100000027 Ga0070665_100000027170 112
9 3300005614 Ga0068856_100016990 Ga0068856_1000169902 112
10 3300005616 Ga0068852_100562798 Ga0068852_1005627981 112
11 3300005842 Ga0068858_100001790 Ga0068858_1000017908 112
12 3300005842 Ga0068858_100339159 Ga0068858_1003391591 112
13 3300009093 Ga0105240_10261108 Ga0105240_102611082 112
14 3300026035 Ga0207703_10001370 Ga0207703_100013708 112
15 3300026078 Ga0207702_10304670 Ga0207702_103046702 112
16 3300028563 Ga0265319_1001493 Ga0265319_10014936 121
17 3300031240 Ga0265320_10001948 Ga0265320_100019486 121
18 3300031240 Ga0265320_10095201 Ga0265320_100952012 121
19 3300031250 Ga0265331_10335439 Ga0265331_103354392 121
20 3300028563 Ga0265319_1010462 Ga0265319_10104624 122
21 3300028577 Ga0265318_10024520 Ga0265318_100245203 122
22 3300031240 Ga0265320_10000431 Ga0265320_100004312 122
23 3300031344 Ga0265316_11226530 Ga0265316_112265302 122
24 3300049742 Ga0501080_0734419 Ga0501080_0734419_251_619 122
25 3300003322 rootL2_10188220 rootL2_101882201 123
26 3300005354 Ga0070675_101971769 Ga0070675_1019717692 123
27 3300005439 Ga0070711_100425840 Ga0070711_1004258402 123
28 3300005539 Ga0068853_100098153 Ga0068853_1000981532 123
29 3300005563 Ga0068855_101757248 Ga0068855_1017572481 123
30 3300014745 Ga0157377_11711528 Ga0157377_117115281 123
31 3300025916 Ga0207663_10289069 Ga0207663_102890692 123
32 3300026023 Ga0207677_11101966 Ga0207677_111019661 123
33 3300028556 Ga0265337_1011773 Ga0265337_10117732 123
34 3300028563 Ga0265319_1002805 Ga0265319_10028057 123
35 3300028563 Ga0265319_1006493 Ga0265319_10064933 123
36 3300028577 Ga0265318_10001330 Ga0265318_100013308 123
37 3300028577 Ga0265318_10002375 Ga0265318_100023757 123
38 3300028577 Ga0265318_10003955 Ga0265318_100039558 123
39 3300028577 Ga0265318_10032357 Ga0265318_100323572 123
40 3300028577 Ga0265318_10091116 Ga0265318_100911162 123
41 3300028653 Ga0265323_10015002 Ga0265323_100150022 123
42 3300028654 Ga0265322_10005195 Ga0265322_100051954 123
43 3300028666 Ga0265336_10000665 Ga0265336_1000066512 123
44 3300028794 Ga0307515_10075945 Ga0307515_100759452 123
45 3300028800 Ga0265338_10005448 Ga0265338_1000544810 123
46 3300029957 Ga0265324_10001940 Ga0265324_100019407 123
47 3300031238 Ga0265332_10088307 Ga0265332_100883071 123
48 3300031238 Ga0265332_10295028 Ga0265332_102950282 123
49 3300031239 Ga0265328_10005553 Ga0265328_100055532 123
50 3300031240 Ga0265320_10006534 Ga0265320_100065347 123
51 3300031240 Ga0265320_10006980 Ga0265320_100069802 123
52 3300031240 Ga0265320_10072998 Ga0265320_100729982 123
53 3300031241 Ga0265325_10041898 Ga0265325_100418982 123
54 3300031242 Ga0265329_10183980 Ga0265329_101839802 123
55 3300031247 Ga0265340_10018027 Ga0265340_100180276 123
56 3300031251 Ga0265327_10000029 Ga0265327_10000029128 123
57 3300031251 Ga0265327_10002468 Ga0265327_1000246819 123
58 3300031344 Ga0265316_10001324 Ga0265316_1000132423 123
59 3300031456 Ga0307513_10426119 Ga0307513_104261192 123
60 3300031711 Ga0265314_10031122 Ga0265314_100311225 123
61 3300031712 Ga0265342_10027012 Ga0265342_100270123 123
62 3300031712 Ga0265342_10249136 Ga0265342_102491362 123
63 3300031824 Ga0307413_10266623 Ga0307413_102666232 123
64 3300031852 Ga0307410_10794948 Ga0307410_107949482 123
65 3300035695 Ga0373927_0205316 Ga0373927_0205316_509_880 123
66 3300037471 Ga0395905_1262900 Ga0395905_1262900_132_509 123
67 3300042876 Ga0451577_0048373 Ga0451577_0048373_1749_2120 123
68 3300042876 Ga0451577_0051889 Ga0451577_0051889_783_1157 123
69 3300042876 Ga0451577_0929261 Ga0451577_0929261_39_410 123
70 3300044712 Ga0453684_0000019 Ga0453684_0000019_437077_437451 123
71 3300044712 Ga0453684_0099878 Ga0453684_0099878_883_1254 123
72 3300049580 Ga0501046_0035823 Ga0501046_0035823_3580_3951 123
73 3300049581 Ga0501047_0032051 Ga0501047_0032051_3016_3387 123
74 3300049650 Ga0501199_022966 Ga0501199_022966_107_478 123
75 3300049686 Ga0501257_252688 Ga0501257_252688_76_447 123
76 3300049744 Ga0501083_0002522 Ga0501083_0002522_6277_6648 123
77 3300049744 Ga0501083_0088432 Ga0501083_0088432_66_437 123
78 3300049744 Ga0501083_0161680 Ga0501083_0161680_789_1160 123
79 3300049822 Ga0501035_0008606 Ga0501035_0008606_5692_6063 123
80 3300053140 Ga0500573_0471054 Ga0500573_0471054_182_553 123
81 3300003320 rootH2_10016165 rootH2_100161651 124
82 3300003322 rootL2_10054276 rootL2_100542764 124
83 3300005842 Ga0068858_101457723 Ga0068858_1014577231 124
84 3300013104 Ga0157370_11702411 Ga0157370_117024112 124
85 3300013308 Ga0157375_11440397 Ga0157375_114403972 124
86 3300028556 Ga0265337_1037907 Ga0265337_10379071 124
87 3300028563 Ga0265319_1009628 Ga0265319_10096285 124
88 3300028563 Ga0265319_1080812 Ga0265319_10808122 124
89 3300028573 Ga0265334_10003350 Ga0265334_100033501 124
90 3300028573 Ga0265334_10127049 Ga0265334_101270492 124
91 3300028577 Ga0265318_10000038 Ga0265318_10000038123 124
92 3300029957 Ga0265324_10087666 Ga0265324_100876662 124
93 3300031238 Ga0265332_10057328 Ga0265332_100573282 124
94 3300031238 Ga0265332_10126695 Ga0265332_101266952 124
95 3300031240 Ga0265320_10037923 Ga0265320_100379232 124
96 3300031247 Ga0265340_10121628 Ga0265340_101216282 124
97 3300031249 Ga0265339_10094488 Ga0265339_100944882 124
98 3300031250 Ga0265331_10002824 Ga0265331_100028247 124
99 3300031250 Ga0265331_10069214 Ga0265331_100692142 124
100 3300031344 Ga0265316_10043409 Ga0265316_100434092 124
101 3300031344 Ga0265316_10264413 Ga0265316_102644132 124
102 3300031595 Ga0265313_10003948 Ga0265313_100039488 124
103 3300031595 Ga0265313_10227373 Ga0265313_102273732 124
104 3300031711 Ga0265314_10007380 Ga0265314_100073807 124
105 3300031711 Ga0265314_10205050 Ga0265314_102050501 124
106 3300031712 Ga0265342_10024622 Ga0265342_100246224 124
107 3300041512 Ga0451853_1215770 Ga0451853_1215770_39_413 124
108 3300042001 Ga0439441_009780 Ga0439441_009780_817_1191 124
109 3300042876 Ga0451577_0000023 Ga0451577_0000023_273727_274101 124
110 3300044712 Ga0453684_0908383 Ga0453684_0908383_542_916 124
111 3300045051 Ga0451576_0068003 Ga0451576_0068003_192_566 124
112 3300049571 Ga0501034_0065425 Ga0501034_0065425_3189_3563 124
113 3300053104 Ga0500556_0275079 Ga0500556_0275079_121_495 124
114 3300053156 Ga0500622_0012059 Ga0500622_0012059_411_785 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

29

123

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7201 1 122
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.687 1 122
4rc6-assembly2.cif.gz_B crystal structure of cyanobacterial aldehyde-deformylating oxygenase 122f mutant 0.6711 83 120
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.6145 57 123
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6114 2 121
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7111 1 122 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6836 1 122 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6558 5 114 3.30.2010.20
af_A0A0R0GDI7_137_270_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.6157 32 123 3.40.390.30
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6114 2 121 3.30.2010.20
ID Description Score Start End GO Terms
AF-A0A257M8I4-F1-model_v4 Neutral zinc metallopeptidase 0.9403 1 124
AF-A0A1V6DGW4-F1-model_v4 Possibl zinc metallo-peptidase 0.9371 1 124
AF-A0A2E9RVD7-F1-model_v4 Metallopeptidase family protein 0.9301 3 124
AF-A0A8A7W741-F1-model_v4 deleted 0.9281 1 124
AF-A0A382GPH4-F1-model_v4 Metallopeptidase family protein 0.9281 21 124

Feature Viewer

pLDDT pTM Quality
92.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map