F080506

General Info

Members Datasets Scaffolds Average Seq Length
114 83 228 104

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0032105|Ga0496115_0032105_2031_2405
Length 124
Sequence MALFTIGSKAVFKTFLIMIHLFKTNVGRLRIIAFLEGLSLLVLIFVAVPLKHFVNDPSVVKTMGPIHGALFLLFVFNALSVGVEQQWKFKETTWKVLLACLIPFGTFYIDHKILAKIPTASNEH

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
22 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
23 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
24 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
25 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
26 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
33 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
39 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
40 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
41 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
42 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
43 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
44 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
45 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
46 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
47 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
48 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
49 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
50 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
51 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
52 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
53 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
57 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
58 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
59 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
60 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
61 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
62 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
63 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
64 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
65 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
66 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
67 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
68 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
69 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
70 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
71 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
72 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
73 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
74 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
75 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
76 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
77 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
78 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
79 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
80 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
81 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
82 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
83 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.98
Metatranscriptomes 0
Isolates 7.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.68
Nodule 0
Rhizoplane 2.63
Rhizosphere 45.61
Stem 0
Stem Tuber 0
Unclassified 12.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0032105 3300048918 Bacteria 4142
2 SwRhRL2b_contig_3860585 2162886007 Unclassified 932
3 JGI25162J39368_1000301 3300002737 Bacteria 45433
4 rootH1_10071059 3300003316 Bacteria 4550
5 rootH2_10107991 3300003320 Bacteria 3547
6 rootH2_10145847 3300003320 Unclassified 1370
7 rootH2_10278925 3300003320 Bacteria 2667
8 rootH2_10284341 3300003320 Unclassified 1594
9 rootL2_10016026 3300003322 Bacteria 9708
10 rootL2_10141642 3300003322 Unclassified 2243
11 rootL2_10249239 3300003322 Bacteria 1316
12 rootL2_10289580 3300003322 Bacteria 2455
13 rootH1_10052920 3300003323 Bacteria 18808
14 rootH1_10108072 3300003323 Unclassified 1349
15 rootH1_10213823 3300003323 Bacteria 2638
16 rootH1_10238186 3300003323 Bacteria 2785
17 rootH1_10247839 3300003323 Bacteria 4490
18 Ga0055531_10000104 3300003794 Bacteria 92278
19 Ga0065704_10070542 3300005289 Bacteria 21184
20 Ga0065704_10078261 3300005289 Unclassified 4480
21 Ga0065704_10136389 3300005289 Bacteria 1566
22 Ga0070667_101536621 3300005367 Bacteria 625
23 Ga0068853_100541547 3300005539 Bacteria 1102
24 Ga0068855_100139124 3300005563 Bacteria 2769
25 Ga0105250_10235898 3300009092 Bacteria 779
26 Ga0105240_10000020 3300009093 Bacteria 399699
27 Ga0105240_10173162 3300009093 Bacteria 2554
28 Ga0105237_10000232 3300009545 Bacteria 79362
29 Ga0105239_10002611 3300010375 Bacteria 22800
30 Ga0105239_10142345 3300010375 Bacteria 2673
31 Ga0157373_11084102 3300013100 Bacteria 600
32 Ga0157371_10004771 3300013102 Bacteria 11688
33 Ga0157371_10758775 3300013102 Unclassified 729
34 Ga0157370_10000841 3300013104 Bacteria 38964
35 Ga0157370_10013508 3300013104 Bacteria 8407
36 Ga0157369_10000766 3300013105 Bacteria 41505
37 Ga0163162_10059656 3300013306 Bacteria 3848
38 Ga0182006_1046906 3300015261 Bacteria 1677
39 Ga0182006_1062579 3300015261 Bacteria 1400
40 Ga0163161_10000119 3300017792 Bacteria 74760
41 Ga0209437_100030 3300025233 Bacteria 532466
42 Ga0209129_1017455 3300025258 Bacteria 1407
43 Ga0209257_1000013 3300025304 Bacteria 1047305
44 Ga0207696_1202484 3300025711 Bacteria 521
45 Ga0207695_10000020 3300025913 Bacteria 723025
46 Ga0207695_10061199 3300025913 Bacteria 3892
47 Ga0207671_10000259 3300025914 Bacteria 79366
48 Ga0207667_10242583 3300025949 Bacteria 1844
49 Ga0207658_12156383 3300025986 Bacteria 506
50 Ga0316176_1072368 3300030732 Bacteria 13938
51 Ga0265327_10013138 3300031251 Bacteria 5519
52 Ga0307408_100001598 3300031548 Bacteria 16745
53 Ga0307405_10000001 3300031731 Bacteria 1731270
54 Ga0307406_10000086 3300031901 Bacteria 52871
55 Ga0307406_10009879 3300031901 Bacteria 5370
56 Ga0307414_10836587 3300032004 Unclassified 841
57 Ga0439431_0001088 3300041997 Bacteria 5886
58 Ga0439445_0112963 3300042004 Bacteria 776
59 Ga0439435_0301987 3300042436 Bacteria 548
60 Ga0495638_0331973 3300046460 Bacteria 809
61 Ga0495650_0115292 3300046471 Bacteria 993
62 Ga0495606_0020025 3300046507 Bacteria 4950
63 Ga0495625_0016796 3300046660 Bacteria 5747
64 Ga0496102_1715402 3300048905 Bacteria 546
65 Ga0496115_0108787 3300048918 Bacteria 2276
66 Ga0496116_0000041 3300048919 Bacteria 343299
67 Ga0496117_0002687 3300048920 Bacteria 21966
68 Ga0496117_0142880 3300048920 Bacteria 1430
69 Ga0496118_0073996 3300048921 Bacteria 2437
70 Ga0496121_0013970 3300048924 Bacteria 8577
71 Ga0496122_0258436 3300048925 Bacteria 968
72 Ga0496124_0090718 3300048927 Bacteria 2492
73 Ga0496124_0215302 3300048927 Bacteria 1450
74 Ga0496124_0498317 3300048927 Bacteria 817
75 Ga0496125_0000026 3300048928 Bacteria 397380
76 Ga0496125_0001214 3300048928 Bacteria 38715
77 Ga0496126_0020005 3300048929 Bacteria 6575
78 Ga0496126_0031992 3300048929 Bacteria 4962
79 Ga0501034_1131621 3300049571 Unclassified 663
80 Ga0501043_0399628 3300049579 Bacteria 1038
81 Ga0501217_010797 3300049661 Bacteria 2009
82 Ga0501238_001711 3300049671 Bacteria 2558
83 Ga0501238_080463 3300049671 Bacteria 513
84 Ga0501241_004897 3300049758 Bacteria 2499
85 Ga0500578_0000324 3300053086 Bacteria 58297
86 Ga0500644_0004874 3300053088 Bacteria 3374
87 Ga0500646_0127418 3300053090 Bacteria 824
88 Ga0500646_0167598 3300053090 Bacteria 737
89 Ga0500646_0270864 3300053090 Bacteria 602
90 Ga0500641_0000006 3300053096 Bacteria 223991
91 Ga0500660_234646 3300053100 Unclassified 585
92 Ga0500569_007310 3300053109 Bacteria 2471
93 Ga0500618_018787 3300053125 Bacteria 1707
94 Ga0500652_271447 3300053131 Unclassified 665
95 Ga0500655_044898 3300053133 Unclassified 872
96 Ga0500658_0017072 3300053134 Unclassified 2708
97 Ga0500559_0047413 3300053136 Bacteria 1887
98 Ga0500577_0018349 3300053142 Bacteria 2247
99 Ga0500589_172658 3300053147 Bacteria 857
100 Ga0500616_0007874 3300053153 Bacteria 6700
101 Ga0500616_0049958 3300053153 Unclassified 2210
102 Ga0500616_0208232 3300053153 Bacteria 861
103 Ga0500622_0000026 3300053156 Bacteria 235660
104 Ga0500622_0000267 3300053156 Bacteria 53425
105 Ga0500627_0154560 3300053158 Bacteria 1036
106 Ga0500656_006391 3300053732 Bacteria 1195
107 2738736460 2738541279 Bacteria 6149495
108 2738768903 2738541285 Bacteria 6150075
109 2739218042 2738543007 Bacteria 6149845
110 2852625429 2852623160 Bacteria 4376875
111 2857617255 2857613821 Bacteria 4917088
112 2896344767 2896344016 Bacteria 3811746
113 2904559405 2904555929 Bacteria 5218588
114 2929157231 2929154850 Bacteria 6753285
115 Ga0496115_0032105
116 SwRhRL2b_contig_3860585
117 JGI25162J39368_1000301
118 rootH1_10071059
119 rootH2_10107991
120 rootH2_10145847
121 rootH2_10278925
122 rootH2_10284341
123 rootL2_10016026
124 rootL2_10141642
125 rootL2_10249239
126 rootL2_10289580
127 rootH1_10052920
128 rootH1_10108072
129 rootH1_10213823
130 rootH1_10238186
131 rootH1_10247839
132 Ga0055531_10000104
133 Ga0065704_10070542
134 Ga0065704_10078261
135 Ga0065704_10136389
136 Ga0070667_101536621
137 Ga0068853_100541547
138 Ga0068855_100139124
139 Ga0105250_10235898
140 Ga0105240_10000020
141 Ga0105240_10173162
142 Ga0105237_10000232
143 Ga0105239_10002611
144 Ga0105239_10142345
145 Ga0157373_11084102
146 Ga0157371_10004771
147 Ga0157371_10758775
148 Ga0157370_10000841
149 Ga0157370_10013508
150 Ga0157369_10000766
151 Ga0163162_10059656
152 Ga0182006_1046906
153 Ga0182006_1062579
154 Ga0163161_10000119
155 Ga0209437_100030
156 Ga0209129_1017455
157 Ga0209257_1000013
158 Ga0207696_1202484
159 Ga0207695_10000020
160 Ga0207695_10061199
161 Ga0207671_10000259
162 Ga0207667_10242583
163 Ga0207658_12156383
164 Ga0316176_1072368
165 Ga0265327_10013138
166 Ga0307408_100001598
167 Ga0307405_10000001
168 Ga0307406_10000086
169 Ga0307406_10009879
170 Ga0307414_10836587
171 Ga0439431_0001088
172 Ga0439445_0112963
173 Ga0439435_0301987
174 Ga0495638_0331973
175 Ga0495650_0115292
176 Ga0495606_0020025
177 Ga0495625_0016796
178 Ga0496102_1715402
179 Ga0496115_0108787
180 Ga0496116_0000041
181 Ga0496117_0002687
182 Ga0496117_0142880
183 Ga0496118_0073996
184 Ga0496121_0013970
185 Ga0496122_0258436
186 Ga0496124_0090718
187 Ga0496124_0215302
188 Ga0496124_0498317
189 Ga0496125_0000026
190 Ga0496125_0001214
191 Ga0496126_0020005
192 Ga0496126_0031992
193 Ga0501034_1131621
194 Ga0501043_0399628
195 Ga0501217_010797
196 Ga0501238_001711
197 Ga0501238_080463
198 Ga0501241_004897
199 Ga0500578_0000324
200 Ga0500644_0004874
201 Ga0500646_0127418
202 Ga0500646_0167598
203 Ga0500646_0270864
204 Ga0500641_0000006
205 Ga0500660_234646
206 Ga0500569_007310
207 Ga0500618_018787
208 Ga0500652_271447
209 Ga0500655_044898
210 Ga0500658_0017072
211 Ga0500559_0047413
212 Ga0500577_0018349
213 Ga0500589_172658
214 Ga0500616_0007874
215 Ga0500616_0049958
216 Ga0500616_0208232
217 Ga0500622_0000026
218 Ga0500622_0000267
219 Ga0500627_0154560
220 Ga0500656_006391
221 2738736460
222 2738768903
223 2739218042
224 2852625429
225 2857617255
226 2896344767
227 2904559405
228 2929157231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12823

DUF3817

Domain of unknown function (DUF3817)

26

115

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8p-assembly3.cif.gz_C crystal structure of the tiam2 phccex domain 0.7035 3 84
5och-assembly2.cif.gz_C the crystal structure of human abcb8 in an outward-facing state 0.677 2 65
8gn2-assembly1.cif.gz_Z crystal structure of ppbq-bound photosystem ii complex 0.6364 1 70
8gn2-assembly1.cif.gz_Z crystal structure of ppbq-bound photosystem ii complex 0.6083 1 70
8div-assembly1.cif.gz_A crystal structure of navab i22v as a basis for the human nav1.7 inherited erythromelalgia i136v mutation 0.4225 5 101
ID Description Score Start End Superfamily
af_Q7JZE1_1_232_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6307 3 83 1.20.1420.10
3wu2z00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Photosystem II PsbZ, reaction centre 0.6148 1 71 1.10.287.740
af_K7KM93_6_135_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6127 12 91 1.20.140.150
3wu2z00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Photosystem II PsbZ, reaction centre 0.6071 1 71 1.10.287.740
af_O01795_1037_1183_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.607 7 75 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A2P2E3N1-F1-model_v4 DUF3817 domain-containing protein 0.9626 8 97 GO:0005886
AF-A0A7X1AVV8-F1-model_v4 DUF3817 domain-containing protein 0.9583 12 91 GO:0005886
AF-A0A7Y2XPU3-F1-model_v4 DUF3817 domain-containing protein 0.9569 7 94 GO:0005886
AF-A0A4Q5QQF0-F1-model_v4 DUF3817 domain-containing protein 0.9555 1 86 GO:0005886
AF-A0A3R8IRV9-F1-model_v4 DUF3817 domain-containing protein 0.9537 5 96 GO:0005886

Map