F083249

General Info

Members Datasets Scaffolds Average Seq Length
115 92 230 116

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100441425|Ga0075429_1004414252
Length 129
Sequence MGTAGRWRGMVSGSRQSPQPYIPDRGDLIWLSFDPQAGREQSGRRPALVLSPAAYNGRTRLALACPITGQVKGYPFEVQLPPGLPIAGVVLADHLRSIDWQARRADPIGVAPVSVVDEVVDRLVPLLRL

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
89 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
92 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 1.74
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 1.74
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 29.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100441425 3300006880 Bacteria 1140
2 Ga0070683_100864430 3300005329 Unclassified 867
3 Ga0070670_100617708 3300005331 Bacteria 971
4 Ga0070666_11287572 3300005335 Unclassified 545
5 Ga0070660_100428379 3300005339 Bacteria 1096
6 Ga0070660_100443554 3300005339 Unclassified 1076
7 Ga0070661_100051545 3300005344 Bacteria 3012
8 Ga0070701_10378251 3300005438 Bacteria 892
9 Ga0070700_100437038 3300005441 Unclassified 992
10 Ga0070708_102277093 3300005445 Bacteria 500
11 Ga0070681_10036819 3300005458 Bacteria 4913
12 Ga0070681_10668034 3300005458 Bacteria 954
13 Ga0068867_101020538 3300005459 Bacteria 751
14 Ga0070679_100073441 3300005530 Bacteria 3412
15 Ga0070693_100130325 3300005547 Bacteria 1571
16 Ga0068855_100074295 3300005563 Bacteria 3949
17 Ga0068857_100028085 3300005577 Bacteria 4963
18 Ga0068856_100143561 3300005614 Bacteria 2395
19 Ga0068852_100335410 3300005616 Bacteria 1472
20 Ga0068859_100610367 3300005617 Unclassified 1184
21 Ga0068858_100199308 3300005842 Bacteria 1892
22 Ga0068858_100874922 3300005842 Unclassified 878
23 Ga0081540_1220856 3300005983 Unclassified 674
24 Ga0075428_101945226 3300006844 Unclassified 610
25 Ga0075430_100002386 3300006846 Bacteria 15615
26 Ga0075430_100015573 3300006846 Bacteria 6472
27 Ga0075431_100466878 3300006847 Unclassified 1256
28 Ga0075429_100010464 3300006880 Bacteria 8026
29 Ga0097620_100610315 3300006931 Unclassified 1184
30 Ga0111539_10163180 3300009094 Bacteria 2606
31 Ga0114129_10003266 3300009147 Bacteria 22758
32 Ga0114129_11582495 3300009147 Bacteria 803
33 Ga0114129_12509124 3300009147 Unclassified 616
34 Ga0105238_10000001 3300009551 Bacteria 2036163
35 Ga0105249_10080637 3300009553 Bacteria 3024
36 Ga0105239_10385896 3300010375 Bacteria 1584
37 Ga0105246_10364216 3300011119 Unclassified 1189
38 Ga0157371_10019139 3300013102 Bacteria 5055
39 Ga0157369_10670826 3300013105 Bacteria 1068
40 Ga0157369_11294071 3300013105 Unclassified 743
41 Ga0157374_11026818 3300013296 Bacteria 844
42 Ga0157374_11350221 3300013296 Unclassified 735
43 Ga0157375_10000004 3300013308 Bacteria 474935
44 Ga0213872_10000664 3300021361 Bacteria 26072
45 Ga0207692_10114549 3300025898 Bacteria 1500
46 Ga0207705_10970064 3300025909 Bacteria 657
47 Ga0207707_10034656 3300025912 Bacteria 4417
48 Ga0207695_10258179 3300025913 Bacteria 1640
49 Ga0207660_10897941 3300025917 Unclassified 723
50 Ga0207657_10063859 3300025919 Unclassified 3146
51 Ga0207652_10024933 3300025921 Bacteria 4966
52 Ga0207681_10021107 3300025923 Bacteria 4135
53 Ga0207711_11139235 3300025941 Unclassified 721
54 Ga0207667_10087078 3300025949 Bacteria 3231
55 Ga0207702_10169498 3300026078 Bacteria 2001
56 Ga0207674_10069022 3300026116 Bacteria 3555
57 Ga0207698_10340701 3300026142 Bacteria 1412
58 Ga0265770_1015706 3300030878 Unclassified 1154
59 Ga0265760_10343239 3300031090 Unclassified 534
60 Ga0265325_10240899 3300031241 Unclassified 822
61 Ga0265339_10411505 3300031249 Unclassified 631
62 Ga0265339_10591782 3300031249 Unclassified 509
63 Ga0265327_10002284 3300031251 Bacteria 20581
64 Ga0265327_10019170 3300031251 Bacteria 4216
65 Ga0265316_10020027 3300031344 Bacteria 5706
66 Ga0265316_10153005 3300031344 Bacteria 1727
67 Ga0265316_10187622 3300031344 Bacteria 1537
68 Ga0316575_10188704 3300031665 Unclassified 857
69 Ga0265314_10084603 3300031711 Bacteria 2082
70 Ga0265314_10420236 3300031711 Bacteria 718
71 Ga0265342_10121442 3300031712 Unclassified 1471
72 Ga0307414_10539624 3300032004 Bacteria 1038
73 Ga0307414_10642706 3300032004 Bacteria 956
74 Ga0373952_0284652 3300035092 Unclassified 510
75 Ga0373933_0169995 3300035724 Bacteria 1387
76 Ga0373937_0078839 3300036401 Bacteria 3044
77 Ga0373937_0998016 3300036401 Unclassified 786
78 Ga0316582_0913801 3300036647 Unclassified 600
79 Ga0436360_0229553 3300039438 Unclassified 707
80 Ga0436361_0493086 3300039447 Unclassified 511
81 Ga0439433_0210402 3300041999 Bacteria 516
82 Ga0451577_0083768 3300042876 Bacteria 2845
83 Ga0451577_0394948 3300042876 Unclassified 1255
84 Ga0453683_0000756 3300044673 Bacteria 32593
85 Ga0453684_0008283 3300044712 Bacteria 18730
86 Ga0453684_0094640 3300044712 Bacteria 3674
87 Ga0453684_0146594 3300044712 Bacteria 2810
88 Ga0453684_0181006 3300044712 Bacteria 2474
89 Ga0495592_0283653 3300046454 Bacteria 1082
90 Ga0495618_0151528 3300046514 Bacteria 1481
91 Ga0495630_0410394 3300046517 Unclassified 1038
92 Ga0495587_0449225 3300046536 Unclassified 714
93 Ga0495667_0025448 3300046559 Bacteria 3988
94 Ga0495635_0307999 3300046663 Bacteria 1061
95 Ga0495657_0048187 3300046675 Bacteria 2876
96 Ga0495623_0009717 3300046679 Bacteria 6243
97 Ga0495680_0328434 3300047322 Bacteria 1069
98 Ga0495675_0045027 3300047444 Bacteria 2810
99 Ga0495675_0741135 3300047444 Unclassified 548
100 Ga0495684_0001338 3300047471 Bacteria 19834
101 Ga0496110_1375069 3300048913 Bacteria 615
102 Ga0496112_1388079 3300048915 Bacteria 617
103 Ga0501040_0105712 3300049576 Bacteria 1967
104 Ga0501069_0728533 3300049585 Bacteria 599
105 Ga0501045_0147464 3300049824 Bacteria 1751
106 nmdc:mga0yw44_862642_c1 3300050492 Bacteria 614
107 nmdc:mga05p37_1016_c1 3300050507 Bacteria 31922
108 nmdc:mga05p37_1183985_c1 3300050507 Bacteria 791
109 nmdc:mga09592_11431_c1 3300050508 Bacteria 7219
110 nmdc:mga0qj67_913_c1 3300050509 Bacteria 20325
111 nmdc:mga06r32_1968_c1 3300050510 Bacteria 18334
112 nmdc:mga08y16_186166_c1 3300050511 Bacteria 2155
113 nmdc:mga08y16_930236_c1 3300050511 Unclassified 854
114 Ga0500555_037537 3300053103 Bacteria 1357
115 2857578760 2857576091 Bacteria 5465855
116 Ga0075429_100441425
117 Ga0070683_100864430
118 Ga0070670_100617708
119 Ga0070666_11287572
120 Ga0070660_100428379
121 Ga0070660_100443554
122 Ga0070661_100051545
123 Ga0070701_10378251
124 Ga0070700_100437038
125 Ga0070708_102277093
126 Ga0070681_10036819
127 Ga0070681_10668034
128 Ga0068867_101020538
129 Ga0070679_100073441
130 Ga0070693_100130325
131 Ga0068855_100074295
132 Ga0068857_100028085
133 Ga0068856_100143561
134 Ga0068852_100335410
135 Ga0068859_100610367
136 Ga0068858_100199308
137 Ga0068858_100874922
138 Ga0081540_1220856
139 Ga0075428_101945226
140 Ga0075430_100002386
141 Ga0075430_100015573
142 Ga0075431_100466878
143 Ga0075429_100010464
144 Ga0097620_100610315
145 Ga0111539_10163180
146 Ga0114129_10003266
147 Ga0114129_11582495
148 Ga0114129_12509124
149 Ga0105238_10000001
150 Ga0105249_10080637
151 Ga0105239_10385896
152 Ga0105246_10364216
153 Ga0157371_10019139
154 Ga0157369_10670826
155 Ga0157369_11294071
156 Ga0157374_11026818
157 Ga0157374_11350221
158 Ga0157375_10000004
159 Ga0213872_10000664
160 Ga0207692_10114549
161 Ga0207705_10970064
162 Ga0207707_10034656
163 Ga0207695_10258179
164 Ga0207660_10897941
165 Ga0207657_10063859
166 Ga0207652_10024933
167 Ga0207681_10021107
168 Ga0207711_11139235
169 Ga0207667_10087078
170 Ga0207702_10169498
171 Ga0207674_10069022
172 Ga0207698_10340701
173 Ga0265770_1015706
174 Ga0265760_10343239
175 Ga0265325_10240899
176 Ga0265339_10411505
177 Ga0265339_10591782
178 Ga0265327_10002284
179 Ga0265327_10019170
180 Ga0265316_10020027
181 Ga0265316_10153005
182 Ga0265316_10187622
183 Ga0316575_10188704
184 Ga0265314_10084603
185 Ga0265314_10420236
186 Ga0265342_10121442
187 Ga0307414_10539624
188 Ga0307414_10642706
189 Ga0373952_0284652
190 Ga0373933_0169995
191 Ga0373937_0078839
192 Ga0373937_0998016
193 Ga0316582_0913801
194 Ga0436360_0229553
195 Ga0436361_0493086
196 Ga0439433_0210402
197 Ga0451577_0083768
198 Ga0451577_0394948
199 Ga0453683_0000756
200 Ga0453684_0008283
201 Ga0453684_0094640
202 Ga0453684_0146594
203 Ga0453684_0181006
204 Ga0495592_0283653
205 Ga0495618_0151528
206 Ga0495630_0410394
207 Ga0495587_0449225
208 Ga0495667_0025448
209 Ga0495635_0307999
210 Ga0495657_0048187
211 Ga0495623_0009717
212 Ga0495680_0328434
213 Ga0495675_0045027
214 Ga0495675_0741135
215 Ga0495684_0001338
216 Ga0496110_1375069
217 Ga0496112_1388079
218 Ga0501040_0105712
219 Ga0501069_0728533
220 Ga0501045_0147464
221 nmdc:mga0yw44_862642_c1
222 nmdc:mga05p37_1016_c1
223 nmdc:mga05p37_1183985_c1
224 nmdc:mga09592_11431_c1
225 nmdc:mga0qj67_913_c1
226 nmdc:mga06r32_1968_c1
227 nmdc:mga08y16_186166_c1
228 nmdc:mga08y16_930236_c1
229 Ga0500555_037537
230 2857578760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

24

127

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d2n-assembly1.cif.gz_D crystal structure of maze-mazf (form-iii) from deinococcus radiodurans 0.9887 3 109
7d2p-assembly1.cif.gz_D crystal structure of maze-mazf (form-ii) from deinococcus radiodurans 0.9804 2 109
7d2p-assembly1.cif.gz_C crystal structure of maze-mazf (form-ii) from deinococcus radiodurans 0.9765 2 109
7d2q-assembly1.cif.gz_E crystal structure of maze-mazf (form-i) from deinococcus radiodurans 0.9743 2 109
7d2n-assembly1.cif.gz_A crystal structure of maze-mazf (form-iii) from deinococcus radiodurans 0.9665 3 109
ID Description Score Start End Superfamily
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.9513 1 109 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.9063 1 109 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8552 4 109 2.30.30.110
1m1fB00 Mainly Beta;Roll;SH3 type barrels.; 0.8477 5 110 2.30.30.110
af_P33647_7_115_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8454 6 108 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A353QEX1-F1-model_v4 mRNA-degrading endonuclease 0.9955 29 108 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A845Z7T8-F1-model_v4 mRNA-degrading endonuclease 0.9934 43 109 GO:0003677
GO:0004519
AF-A0A1F9CI30-F1-model_v4 mRNA-degrading endonuclease 0.9921 42 111 GO:0003677
AF-A0A3N5RPJ6-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9876 32 110 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A268S4I6-F1-model_v4 mRNA-degrading endonuclease 0.9801 45 107 GO:0003677
GO:0004519

Map