F084151

General Info

Members Datasets Scaffolds Average Seq Length
115 86 230 224

Family's Representative Sequence

Representative Sequence 3300028666|Ga0265336_10034237|Ga0265336_100342372
Length 252
Sequence MHHLANARVGLNNLIKKTTMNFAEQILAFNQSLVIDESLLPEGIAVMNPFRDERVLQITQTFYRKYFDDNQKRFMIIGINPGRFGGGVTGIPFTDPHKLNNYCGIKIGDLSAPELSADFVYNVINQYGGTEKFYKKFFLTAVSPLGFLKSKNGKMINYNYYDSNELQEAIRDFIIDSITRQLAFGIHRSVCFCLGTGKNYEYLSKLNASHGFFKEIVPLSHPRFVMQYRRKKIDQFVDEYLAAFKMAEAKIL

Samples

Sample ID Description Type Environment
1 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
72 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
73 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
74 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
78 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
79 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
80 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
81 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
82 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
83 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
84 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
85 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
86 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.17
Nodule 0
Rhizoplane 0.87
Rhizosphere 71.3
Stem 0
Stem Tuber 0
Unclassified 14.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265336_10034237 3300028666 Bacteria 1571
2 rootH1_10001324 3300003316 Bacteria 8014
3 rootH2_10003834 3300003320 Bacteria 38010
4 rootH2_10027706 3300003320 Bacteria 2504
5 rootL2_10000507 3300003322 Bacteria 11641
6 rootL2_10008987 3300003322 Bacteria 11457
7 rootL2_10123716 3300003322 Bacteria 3783
8 rootL2_10142361 3300003322 Bacteria 1289
9 rootH1_10013570 3300003323 Bacteria 15862
10 rootH1_10083436 3300003323 Bacteria 2058
11 rootH1_10212796 3300003323 Bacteria 5777
12 Ga0065165_1001051 3300005262 Bacteria 33237
13 Ga0070676_10368171 3300005328 Unclassified 992
14 Ga0070683_100007365 3300005329 Bacteria 9297
15 Ga0070666_10000132 3300005335 Bacteria 52718
16 Ga0068868_100109346 3300005338 Unclassified 2245
17 Ga0070691_10018495 3300005341 Unclassified 3213
18 Ga0070691_10099150 3300005341 Bacteria 1445
19 Ga0070671_100093257 3300005355 Bacteria 2524
20 Ga0070674_100500004 3300005356 Bacteria 1012
21 Ga0070673_100088594 3300005364 Bacteria 2524
22 Ga0070688_100281396 3300005365 Bacteria 1195
23 Ga0068867_100051069 3300005459 Bacteria 3049
24 Ga0068867_100319945 3300005459 Bacteria 1285
25 Ga0068867_100600444 3300005459 Bacteria 960
26 Ga0070707_100373829 3300005468 Bacteria 1385
27 Ga0070684_100007719 3300005535 Bacteria 8386
28 Ga0068855_100000454 3300005563 Bacteria 50341
29 Ga0068854_100129212 3300005578 Unclassified 1927
30 Ga0068852_100280236 3300005616 Unclassified 1607
31 Ga0068859_100433901 3300005617 Bacteria 1410
32 Ga0068866_10236149 3300005718 Bacteria 1111
33 Ga0068860_100052497 3300005843 Bacteria 3878
34 Ga0097621_100032155 3300006237 Bacteria 4169
35 Ga0097621_100348253 3300006237 Unclassified 1317
36 Ga0068871_100491512 3300006358 Bacteria 1105
37 Ga0075431_101123587 3300006847 Bacteria 750
38 Ga0068865_100442334 3300006881 Bacteria 1073
39 Ga0068865_100925482 3300006881 Bacteria 759
40 Ga0097620_100433898 3300006931 Bacteria 1410
41 Ga0105240_10005924 3300009093 Bacteria 18106
42 Ga0105240_10842555 3300009093 Bacteria 990
43 Ga0111539_10038656 3300009094 Bacteria 5758
44 Ga0105245_10222584 3300009098 Bacteria 1822
45 Ga0105241_10035268 3300009174 Bacteria 3762
46 Ga0105241_10518189 3300009174 Unclassified 1066
47 Ga0105242_10129643 3300009176 Bacteria 2175
48 Ga0105242_10369221 3300009176 Bacteria 1330
49 Ga0105239_10005357 3300010375 Bacteria 15059
50 Ga0105239_10079290 3300010375 Bacteria 3614
51 Ga0105239_10637033 3300010375 Bacteria 1217
52 Ga0157371_10047012 3300013102 Bacteria 3067
53 Ga0157369_10121428 3300013105 Unclassified 2772
54 Ga0157374_10662822 3300013296 Bacteria 1055
55 Ga0157378_10771966 3300013297 Unclassified 985
56 Ga0163162_10003888 3300013306 Bacteria 14336
57 Ga0163162_10211178 3300013306 Bacteria 2071
58 Ga0157372_10008075 3300013307 Bacteria 11195
59 Ga0157372_10025440 3300013307 Bacteria 6436
60 Ga0157372_10669441 3300013307 Bacteria 1208
61 Ga0157380_10012287 3300014326 Bacteria 6207
62 Ga0157380_10125808 3300014326 Bacteria 2178
63 Ga0163161_10210705 3300017792 Bacteria 1501
64 Ga0209050_1003237 3300025298 Bacteria 12267
65 Ga0209050_1020527 3300025298 Bacteria 2455
66 Ga0207647_10060433 3300025904 Bacteria 2316
67 Ga0207695_10000073 3300025913 Bacteria 312565
68 Ga0207695_10630400 3300025913 Bacteria 953
69 Ga0207671_10682840 3300025914 Bacteria 817
70 Ga0207661_10003174 3300025944 Bacteria 11401
71 Ga0207667_10000745 3300025949 Bacteria 42269
72 Ga0207651_10131865 3300025960 Bacteria 1914
73 Ga0207648_10014157 3300026089 Bacteria 7377
74 Ga0207648_10102101 3300026089 Bacteria 2513
75 Ga0207648_10887212 3300026089 Bacteria 833
76 Ga0207676_10601884 3300026095 Bacteria 1056
77 Ga0207698_10262291 3300026142 Bacteria 1588
78 Ga0307515_10000003 3300028794 Bacteria 891317
79 Ga0307515_10000031 3300028794 Bacteria 358648
80 Ga0307515_10083754 3300028794 Bacteria 4107
81 Ga0307515_10207006 3300028794 Bacteria 1818
82 Ga0307513_10064498 3300031456 Unclassified 3860
83 Ga0307513_10119219 3300031456 Bacteria 2611
84 Ga0307509_10080599 3300031507 Unclassified 3366
85 Ga0307408_100024939 3300031548 Bacteria 4090
86 Ga0307514_10164506 3300031649 Bacteria 1462
87 Ga0307405_10140927 3300031731 Bacteria 1681
88 Ga0307413_10790189 3300031824 Unclassified 797
89 Ga0307407_10114336 3300031903 Bacteria 1700
90 Ga0307409_100001277 3300031995 Bacteria 12169
91 Ga0307416_100000638 3300032002 Bacteria 18094
92 Ga0307415_100001717 3300032126 Bacteria 10655
93 Ga0451807_2372668 3300041486 Unclassified 716
94 Ga0451577_0020593 3300042876 Bacteria 6049
95 Ga0453684_0000626 3300044712 Bacteria 128697
96 Ga0495638_0000005 3300046460 Bacteria 680627
97 Ga0501300_010712 3300049523 Bacteria 1336
98 Ga0501047_0177121 3300049581 Unclassified 2000
99 Ga0501202_002974 3300049652 Bacteria 2876
100 Ga0501247_003796 3300049677 Unclassified 1634
101 Ga0501264_000224 3300049761 Bacteria 9262
102 Ga0501271_005795 3300049768 Bacteria 1213
103 nmdc:mga0qj67_455420_c1 3300050509 Bacteria 1030
104 nmdc:mga08y16_64892_c1 3300050511 Bacteria 3812
105 Ga0500644_0043237 3300053088 Unclassified 1506
106 Ga0500583_0209446 3300053092 Bacteria 968
107 Ga0500557_070375 3300053105 Bacteria 1147
108 Ga0500562_036993 3300053108 Unclassified 1295
109 Ga0500597_184539 3300053120 Bacteria 883
110 Ga0500568_0113664 3300053139 Bacteria 1011
111 Ga0500588_0000628 3300053146 Bacteria 5853
112 Ga0500604_0027838 3300053151 Bacteria 1638
113 Ga0500616_0000003 3300053153 Bacteria 1220687
114 Ga0500622_0000041 3300053156 Bacteria 170067
115 Ga0500622_0000045 3300053156 Bacteria 158316
116 Ga0265336_10034237
117 rootH1_10001324
118 rootH2_10003834
119 rootH2_10027706
120 rootL2_10000507
121 rootL2_10008987
122 rootL2_10123716
123 rootL2_10142361
124 rootH1_10013570
125 rootH1_10083436
126 rootH1_10212796
127 Ga0065165_1001051
128 Ga0070676_10368171
129 Ga0070683_100007365
130 Ga0070666_10000132
131 Ga0068868_100109346
132 Ga0070691_10018495
133 Ga0070691_10099150
134 Ga0070671_100093257
135 Ga0070674_100500004
136 Ga0070673_100088594
137 Ga0070688_100281396
138 Ga0068867_100051069
139 Ga0068867_100319945
140 Ga0068867_100600444
141 Ga0070707_100373829
142 Ga0070684_100007719
143 Ga0068855_100000454
144 Ga0068854_100129212
145 Ga0068852_100280236
146 Ga0068859_100433901
147 Ga0068866_10236149
148 Ga0068860_100052497
149 Ga0097621_100032155
150 Ga0097621_100348253
151 Ga0068871_100491512
152 Ga0075431_101123587
153 Ga0068865_100442334
154 Ga0068865_100925482
155 Ga0097620_100433898
156 Ga0105240_10005924
157 Ga0105240_10842555
158 Ga0111539_10038656
159 Ga0105245_10222584
160 Ga0105241_10035268
161 Ga0105241_10518189
162 Ga0105242_10129643
163 Ga0105242_10369221
164 Ga0105239_10005357
165 Ga0105239_10079290
166 Ga0105239_10637033
167 Ga0157371_10047012
168 Ga0157369_10121428
169 Ga0157374_10662822
170 Ga0157378_10771966
171 Ga0163162_10003888
172 Ga0163162_10211178
173 Ga0157372_10008075
174 Ga0157372_10025440
175 Ga0157372_10669441
176 Ga0157380_10012287
177 Ga0157380_10125808
178 Ga0163161_10210705
179 Ga0209050_1003237
180 Ga0209050_1020527
181 Ga0207647_10060433
182 Ga0207695_10000073
183 Ga0207695_10630400
184 Ga0207671_10682840
185 Ga0207661_10003174
186 Ga0207667_10000745
187 Ga0207651_10131865
188 Ga0207648_10014157
189 Ga0207648_10102101
190 Ga0207648_10887212
191 Ga0207676_10601884
192 Ga0207698_10262291
193 Ga0307515_10000003
194 Ga0307515_10000031
195 Ga0307515_10083754
196 Ga0307515_10207006
197 Ga0307513_10064498
198 Ga0307513_10119219
199 Ga0307509_10080599
200 Ga0307408_100024939
201 Ga0307514_10164506
202 Ga0307405_10140927
203 Ga0307413_10790189
204 Ga0307407_10114336
205 Ga0307409_100001277
206 Ga0307416_100000638
207 Ga0307415_100001717
208 Ga0451807_2372668
209 Ga0451577_0020593
210 Ga0453684_0000626
211 Ga0495638_0000005
212 Ga0501300_010712
213 Ga0501047_0177121
214 Ga0501202_002974
215 Ga0501247_003796
216 Ga0501264_000224
217 Ga0501271_005795
218 nmdc:mga0qj67_455420_c1
219 nmdc:mga08y16_64892_c1
220 Ga0500644_0043237
221 Ga0500583_0209446
222 Ga0500557_070375
223 Ga0500562_036993
224 Ga0500597_184539
225 Ga0500568_0113664
226 Ga0500588_0000628
227 Ga0500604_0027838
228 Ga0500616_0000003
229 Ga0500622_0000041
230 Ga0500622_0000045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

64

245

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h0k-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9744 16 235
5h0j-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9742 16 235
5h0k-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9131 16 235
5h0j-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9129 16 235
1oe6-assembly1.cif.gz_A xenopus smug1, an anti-mutator uracil-dna glycosylase 0.7678 19 235
ID Description Score Start End Superfamily
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7844 18 234 3.40.470.10
af_Q9VEM1_36_278_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7548 19 234 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.736 19 238 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7301 19 238 3.40.470.10
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7197 18 234 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A385SDU8-F1-model_v4 DUF4918 family protein 0.9965 17 237
AF-A0A6N4EE79-F1-model_v4 deleted 0.9929 137 234
AF-A0A7V4YUY9-F1-model_v4 DUF4918 family protein 0.9893 83 233
AF-A0A385SDU8-F1-model_v4 DUF4918 family protein 0.9876 17 237
AF-A0A081SIB8-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9872 17 234

Map