F086294

General Info

Members Datasets Scaffolds Average Seq Length
116 73 110 105

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10029332|rootH2_100293328
Length 118
Sequence MSSVYSINKGINKAISFKGLKAQYIGYLAGGLVALLIGFAVLYICGVNTYVCVVLTGGLGTGLVMTVFRMSHRYGQYGLLKRNANRQIPDYLKFHSRKLFTNLKSKSSLPGRIKEGLL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
5 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
36 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
37 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
64 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
65 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
66 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
67 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
70 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
71 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
72 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
73 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.1
Metatranscriptomes 0.86
Isolates 6.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 0
Rhizoplane 0.86
Rhizosphere 69.83
Stem 0
Stem Tuber 0
Unclassified 12.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007610 3300001904 Bacteria 1818
2 JGI25157J39369_1024026 3300002741 Bacteria 715
3 rootH1_10002029 3300003316 Bacteria 4220
4 rootH1_10002029 3300003323 Bacteria 1946
5 rootH2_10029332 3300003320 Bacteria 36860
6 rootH2_10127644 3300003320 Bacteria 2111
7 rootH1_10038614 3300003323 Bacteria 23905
8 rootH1_10202484 3300003323 Bacteria 1591
9 Ga0065714_10017140 3300005288 Bacteria 1673
10 Ga0065714_10069453 3300005288 Bacteria 4223
11 Ga0065714_10165923 3300005288 Bacteria 1028
12 Ga0065704_10253965 3300005289 Bacteria 982
13 Ga0070658_10359745 3300005327 Bacteria 1246
14 Ga0070658_11305158 3300005327 Unclassified 630
15 Ga0070691_10025162 3300005341 Bacteria 2771
16 Ga0070659_100371967 3300005366 Bacteria 1202
17 Ga0070681_10083846 3300005458 Unclassified 3140
18 Ga0070679_100021826 3300005530 Bacteria 6253
19 Ga0068853_100011837 3300005539 Bacteria 7092
20 Ga0068853_100198437 3300005539 Unclassified 1825
21 Ga0068855_100000014 3300005563 Bacteria 232720
22 Ga0068855_100002488 3300005563 Bacteria 22689
23 Ga0068856_100000536 3300005614 Bacteria 41838
24 Ga0075366_10005971 3300006195 Bacteria 6630
25 Ga0075366_10006501 3300006195 Bacteria 6408
26 Ga0075366_10043930 3300006195 Bacteria 2648
27 Ga0075366_10148647 3300006195 Bacteria 1418
28 Ga0105240_10117863 3300009093 Bacteria 3201
29 Ga0105240_11266522 3300009093 Bacteria 779
30 Ga0105237_10000125 3300009545 Bacteria 107351
31 Ga0105237_10000496 3300009545 Bacteria 55702
32 Ga0105237_10000533 3300009545 Bacteria 53639
33 Ga0105237_10096203 3300009545 Bacteria 2952
34 Ga0105238_10056210 3300009551 Bacteria 3949
35 Ga0105239_10000006 3300010375 Bacteria 442319
36 Ga0157371_10005882 3300013102 Bacteria 10245
37 Ga0157371_10547328 3300013102 Bacteria 858
38 Ga0157371_10918267 3300013102 Bacteria 665
39 Ga0157370_10363672 3300013104 Bacteria 1333
40 Ga0157369_10000419 3300013105 Bacteria 56158
41 Ga0157374_10833255 3300013296 Bacteria 939
42 Ga0157374_11102180 3300013296 Bacteria 814
43 Ga0163162_10000229 3300013306 Bacteria 51289
44 Ga0163162_10001507 3300013306 Bacteria 21706
45 Ga0163162_10131114 3300013306 Bacteria 2615
46 Ga0163162_10224969 3300013306 Bacteria 2006
47 Ga0157372_10014772 3300013307 Bacteria 8358
48 Ga0206352_11008672 3300020078 Bacteria 2926
49 Ga0207427_125938 3300025231 Bacteria 509
50 Ga0209258_129231 3300025242 Bacteria 521
51 Ga0209026_1000684 3300025250 Bacteria 20431
52 Ga0209026_1008162 3300025250 Bacteria 2226
53 Ga0209026_1065975 3300025250 Unclassified 506
54 Ga0209129_1014327 3300025258 Bacteria 1694
55 Ga0209233_1000604 3300025261 Bacteria 18532
56 Ga0209233_1010576 3300025261 Bacteria 2758
57 Ga0209233_1067750 3300025261 Bacteria 670
58 Ga0209758_1000922 3300025297 Bacteria 39755
59 Ga0207426_1057275 3300025302 Unclassified 1135
60 Ga0207647_10000140 3300025904 Bacteria 57457
61 Ga0207647_10481808 3300025904 Bacteria 693
62 Ga0207705_10307172 3300025909 Bacteria 1217
63 Ga0207705_10418064 3300025909 Unclassified 1038
64 Ga0207707_10074099 3300025912 Unclassified 2969
65 Ga0207671_10000112 3300025914 Bacteria 125310
66 Ga0207671_10000850 3300025914 Bacteria 38725
67 Ga0207671_10012971 3300025914 Bacteria 6667
68 Ga0207671_10102012 3300025914 Bacteria 2174
69 Ga0207652_10062113 3300025921 Bacteria 3228
70 Ga0207690_10441079 3300025932 Bacteria 1045
71 Ga0207667_10000049 3300025949 Bacteria 235027
72 Ga0207667_10021428 3300025949 Bacteria 7161
73 Ga0207667_10027432 3300025949 Bacteria 6199
74 Ga0207639_10008112 3300026041 Bacteria 7179
75 Ga0207639_10168657 3300026041 Unclassified 1852
76 Ga0207702_10044937 3300026078 Bacteria 3715
77 Ga0207676_10477523 3300026095 Unclassified 1180
78 Ga0207674_10875607 3300026116 Bacteria 866
79 Ga0307515_10000203 3300028794 Bacteria 145242
80 Ga0307515_10000523 3300028794 Bacteria 91316
81 Ga0307512_10366299 3300030522 Unclassified 625
82 Ga0265327_10105257 3300031251 Unclassified 1356
83 Ga0307408_101051358 3300031548 Bacteria 753
84 Ga0307414_10000072 3300032004 Bacteria 94883
85 Ga0307414_10234269 3300032004 Unclassified 1516
86 Ga0307414_12232088 3300032004 Unclassified 511
87 Ga0395899_0000001 3300037312 Bacteria 1750322
88 Ga0395899_0599340 3300037312 Bacteria 702
89 Ga0395900_0000048 3300037418 Bacteria 227760
90 Ga0466966_0012293 3300044684 Bacteria 5672
91 Ga0466961_0011210 3300044693 Bacteria 5732
92 Ga0466959_0193612 3300045049 Bacteria 1418
93 Ga0495605_0468348 3300046474 Unclassified 517
94 Ga0495585_0017111 3300046492 Bacteria 4196
95 Ga0495610_0054562 3300046512 Bacteria 1930
96 Ga0495648_0015310 3300046524 Bacteria 5576
97 Ga0495625_0070818 3300046660 Bacteria 2448
98 Ga0495625_0546498 3300046660 Unclassified 702
99 Ga0495661_0001723 3300046665 Bacteria 17703
100 Ga0495660_0018509 3300046810 Bacteria 4006
101 Ga0495602_0836401 3300048088 Bacteria 616
102 Ga0495678_010494 3300049459 Bacteria 4501
103 Ga0501300_003336 3300049523 Bacteria 2397
104 nmdc:mga0k408_10408_c1 3300050493 Bacteria 5029
105 nmdc:mga0k408_140939_c1 3300050493 Bacteria 1434
106 nmdc:mga0k408_149353_c1 3300050493 Bacteria 1391
107 nmdc:mga0k408_2895_c1 3300050493 Bacteria 9098
108 nmdc:mga0k408_7700_c1 3300050493 Bacteria 5757
109 Ga0500564_308361 3300053138 Unclassified 604
110 Ga0500624_000459 3300053157 Bacteria 12195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049523 Ga0501300_003336 Ga0501300_003336_1771_2115 89
2 3300028794 Ga0307515_10000203 Ga0307515_1000020327 90
3 3300031548 Ga0307408_101051358 Ga0307408_1010513582 91
4 3300005288 Ga0065714_10069453 Ga0065714_100694535 93
5 3300013102 Ga0157371_10547328 Ga0157371_105473282 93
6 3300009551 Ga0105238_10056210 Ga0105238_100562101 94
7 3300032004 Ga0307414_12232088 Ga0307414_122320881 97
8 iso_pu_bacteria 2884933994 2884936825 98
9 iso_pu_bacteria 2932082852 2932083130 98
10 3300005458 Ga0070681_10083846 Ga0070681_100838462 100
11 3300005530 Ga0070679_100021826 Ga0070679_1000218266 100
12 3300025912 Ga0207707_10074099 Ga0207707_100740995 100
13 3300025921 Ga0207652_10062113 Ga0207652_100621132 100
14 iso_pu_bacteria 2599185184 2599476695 100
15 iso_pu_bacteria 2884933994 2884935323 100
16 iso_pu_bacteria 2928078545 2928081490 100
17 iso_pu_bacteria 2977232053 2977232161 100
18 iso_pu_bacteria 2977232053 2977232219 100
19 3300046810 Ga0495660_0018509 Ga0495660_0018509_1565_1870 101
20 3300003320 rootH2_10127644 rootH2_101276444 102
21 3300003323 rootH1_10202484 rootH1_102024842 102
22 3300005288 Ga0065714_10017140 Ga0065714_100171403 102
23 3300005288 Ga0065714_10165923 Ga0065714_101659232 102
24 3300005327 Ga0070658_11305158 Ga0070658_113051582 102
25 3300005539 Ga0068853_100198437 Ga0068853_1001984374 102
26 3300006195 Ga0075366_10005971 Ga0075366_100059716 102
27 3300006195 Ga0075366_10043930 Ga0075366_100439303 102
28 3300009093 Ga0105240_10117863 Ga0105240_101178632 102
29 3300009545 Ga0105237_10000496 Ga0105237_1000049618 102
30 3300009545 Ga0105237_10096203 Ga0105237_100962031 102
31 3300010375 Ga0105239_10000006 Ga0105239_10000006305 102
32 3300013102 Ga0157371_10005882 Ga0157371_100058826 102
33 3300013102 Ga0157371_10918267 Ga0157371_109182672 102
34 3300013104 Ga0157370_10363672 Ga0157370_103636721 102
35 3300013296 Ga0157374_10833255 Ga0157374_108332552 102
36 3300013296 Ga0157374_11102180 Ga0157374_111021802 102
37 3300013306 Ga0163162_10131114 Ga0163162_101311142 102
38 3300013306 Ga0163162_10224969 Ga0163162_102249692 102
39 3300025258 Ga0209129_1014327 Ga0209129_10143273 102
40 3300025909 Ga0207705_10418064 Ga0207705_104180642 102
41 3300025914 Ga0207671_10012971 Ga0207671_100129719 102
42 3300025914 Ga0207671_10102012 Ga0207671_101020124 102
43 3300026041 Ga0207639_10168657 Ga0207639_101686574 102
44 3300030522 Ga0307512_10366299 Ga0307512_103662992 102
45 3300031251 Ga0265327_10105257 Ga0265327_101052573 102
46 3300037418 Ga0395900_0000048 Ga0395900_0000048_27179_27487 102
47 3300049459 Ga0495678_010494 Ga0495678_010494_54_362 102
48 3300050493 nmdc:mga0k408_10408_c1 nmdc:mga0k408_10408_c1_4251_4559 102
49 3300050493 nmdc:mga0k408_7700_c1 nmdc:mga0k408_7700_c1_1978_2286 102
50 3300048088 Ga0495602_0836401 Ga0495602_0836401_17_328 103
51 3300053157 Ga0500624_000459 Ga0500624_000459_5919_6230 103
52 3300001904 JGI24736J21556_1007610 JGI24736J21556_10076102 104
53 3300002741 JGI25157J39369_1024026 JGI25157J39369_10240262 104
54 3300003316 rootH1_10002029 rootH1_100020294 104
55 3300003320 rootH2_10029332 rootH2_100293328 104
56 3300003323 rootH1_10038614 rootH1_100386148 104
57 3300005289 Ga0065704_10253965 Ga0065704_102539652 104
58 3300005327 Ga0070658_10359745 Ga0070658_103597453 104
59 3300005341 Ga0070691_10025162 Ga0070691_100251626 104
60 3300005366 Ga0070659_100371967 Ga0070659_1003719672 104
61 3300005539 Ga0068853_100011837 Ga0068853_1000118377 104
62 3300005563 Ga0068855_100000014 Ga0068855_10000001489 104
63 3300005563 Ga0068855_100002488 Ga0068855_10000248815 104
64 3300005614 Ga0068856_100000536 Ga0068856_1000005363 104
65 3300006195 Ga0075366_10006501 Ga0075366_100065012 104
66 3300006195 Ga0075366_10148647 Ga0075366_101486472 104
67 3300009093 Ga0105240_11266522 Ga0105240_112665221 104
68 3300009545 Ga0105237_10000125 Ga0105237_1000012522 104
69 3300009545 Ga0105237_10000533 Ga0105237_1000053324 104
70 3300013105 Ga0157369_10000419 Ga0157369_1000041934 104
71 3300013306 Ga0163162_10000229 Ga0163162_1000022918 104
72 3300013306 Ga0163162_10001507 Ga0163162_1000150723 104
73 3300013307 Ga0157372_10014772 Ga0157372_1001477210 104
74 3300020078 Ga0206352_11008672 Ga0206352_110086722 104
75 3300025231 Ga0207427_125938 Ga0207427_1259382 104
76 3300025242 Ga0209258_129231 Ga0209258_1292311 104
77 3300025250 Ga0209026_1000684 Ga0209026_100068415 104
78 3300025250 Ga0209026_1008162 Ga0209026_10081622 104
79 3300025250 Ga0209026_1065975 Ga0209026_10659751 104
80 3300025261 Ga0209233_1000604 Ga0209233_100060410 104
81 3300025261 Ga0209233_1010576 Ga0209233_10105762 104
82 3300025261 Ga0209233_1067750 Ga0209233_10677501 104
83 3300025297 Ga0209758_1000922 Ga0209758_10009229 104
84 3300025302 Ga0207426_1057275 Ga0207426_10572751 104
85 3300025904 Ga0207647_10000140 Ga0207647_100001407 104
86 3300025904 Ga0207647_10481808 Ga0207647_104818082 104
87 3300025909 Ga0207705_10307172 Ga0207705_103071723 104
88 3300025914 Ga0207671_10000112 Ga0207671_1000011237 104
89 3300025914 Ga0207671_10000850 Ga0207671_100008506 104
90 3300025932 Ga0207690_10441079 Ga0207690_104410792 104
91 3300025949 Ga0207667_10000049 Ga0207667_1000004987 104
92 3300025949 Ga0207667_10021428 Ga0207667_100214284 104
93 3300025949 Ga0207667_10027432 Ga0207667_100274323 104
94 3300026041 Ga0207639_10008112 Ga0207639_100081127 104
95 3300026078 Ga0207702_10044937 Ga0207702_100449373 104
96 3300026095 Ga0207676_10477523 Ga0207676_104775231 104
97 3300026116 Ga0207674_10875607 Ga0207674_108756071 104
98 3300028794 Ga0307515_10000523 Ga0307515_1000052362 104
99 3300032004 Ga0307414_10000072 Ga0307414_1000007223 104
100 3300032004 Ga0307414_10234269 Ga0307414_102342692 104
101 3300037312 Ga0395899_0000001 Ga0395899_0000001_265314_265628 104
102 3300037312 Ga0395899_0599340 Ga0395899_0599340_329_658 104
103 3300044684 Ga0466966_0012293 Ga0466966_0012293_5297_5626 104
104 3300044693 Ga0466961_0011210 Ga0466961_0011210_4113_4442 104
105 3300045049 Ga0466959_0193612 Ga0466959_0193612_221_550 104
106 3300046474 Ga0495605_0468348 Ga0495605_0468348_186_500 104
107 3300046492 Ga0495585_0017111 Ga0495585_0017111_3239_3562 104
108 3300046512 Ga0495610_0054562 Ga0495610_0054562_153_467 104
109 3300046524 Ga0495648_0015310 Ga0495648_0015310_1369_1719 104
110 3300046660 Ga0495625_0070818 Ga0495625_0070818_1876_2205 104
111 3300046660 Ga0495625_0546498 Ga0495625_0546498_84_422 104
112 3300046665 Ga0495661_0001723 Ga0495661_0001723_13084_13398 104
113 3300050493 nmdc:mga0k408_140939_c1 nmdc:mga0k408_140939_c1_706_1038 104
114 3300050493 nmdc:mga0k408_149353_c1 nmdc:mga0k408_149353_c1_51_365 104
115 3300050493 nmdc:mga0k408_2895_c1 nmdc:mga0k408_2895_c1_1238_1585 104
116 3300053138 Ga0500564_308361 Ga0500564_308361_13_327 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13571

DUF4133

Domain of unknown function (DUF4133)

7

97

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6koo-assembly1.cif.gz_D mycobacterium tuberculosis initial transcription complex comprising sigma h and 5'-oh rna of 7 nt 0.5213 13 88
8cwy-assembly1.cif.gz_R accurate computational design of genetically encoded 3d protein crystals 0.4915 13 84
8cwy-assembly1.cif.gz_R accurate computational design of genetically encoded 3d protein crystals 0.4734 13 84
8ap6-assembly1.cif.gz_O trypanosoma brucei mitochondrial f1fo atp synthase dimer 0.4699 10 90
6koo-assembly1.cif.gz_D mycobacterium tuberculosis initial transcription complex comprising sigma h and 5'-oh rna of 7 nt 0.408 13 88
ID Description Score Start End Superfamily
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8805 15 66 1.20.1070.10
af_Q2FVU8_1_63_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7888 20 75 1.20.20.10
af_Q93XX4_1_272_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.7227 27 85 3.15.10.10
af_G5EG10_589_823_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.71 8 73 1.20.1070.10
af_Q2FVU8_1_63_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7069 20 75 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A432J9C7-F1-model_v4 deleted 0.7925 21 104
AF-F5UD98-F1-model_v4 deleted 0.7813 13 83
AF-A0A432J9C7-F1-model_v4 deleted 0.7747 21 104
AF-U2K5Y7-F1-model_v4 Conjugative transposon protein TraF family protein 0.7482 4 88 GO:0016020
AF-A0A6L8Z6V0-F1-model_v4 deleted 0.7375 4 85

Feature Viewer

pLDDT pTM Quality
76.64 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map