F089534

General Info

Members Datasets Scaffolds Average Seq Length
116 70 232 301

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0103365|Ga0451576_0103365_60_1124
Length 354
Sequence LSILFLDNFIHGLKQTTVLKCGALDWAVEGYCLPIGRAIYYIATGLQTIKKLDAGAMSTPLVALKIDVDTFAGTRDGVPRLLATLHDFNIKATFYFSMGPDNSGKAIRRIFTRKGFLRKMLRTRAPSAYGIKTMLYGTLLPAPMIADSFPTVLQSVVQQGHEAGIHCWDHVKWHDLLPWFPKPVTAMELGRAGSCFEAIFGFRARTTAAPGWTVSQDSLEVQDAMSLAYCSDSRGTHPFYPVMNGRRFNTLQIPSTWPTMDEILGENGVTSENINDLYLSLLKPGLNVHTIHAELEGGVLSATFVDLLKRLQAAGVRFITLAEAAEESALSAPDSVLEMGEIPGRAGNVAVQRA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
52 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
53 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
54 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
63 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
66 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
69 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
70 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0103365 3300045051 Unclassified 2964
2 JGI24746J21847_1000286 3300001977 Bacteria 7219
3 rootH1_10029717 3300003323 Bacteria 4555
4 rootH1_10224799 3300003323 Bacteria 2100
5 Ga0065707_10001952 3300005295 Bacteria 8818
6 Ga0065707_10087787 3300005295 Bacteria 4891
7 Ga0070676_10032594 3300005328 Bacteria 2986
8 Ga0070670_100235201 3300005331 Bacteria 1595
9 Ga0068869_100241892 3300005334 Bacteria 1438
10 Ga0070666_10000726 3300005335 Bacteria 19972
11 Ga0070661_100005313 3300005344 Bacteria 8882
12 Ga0070667_100026343 3300005367 Bacteria 4836
13 Ga0070709_10000490 3300005434 Bacteria 23381
14 Ga0068867_100000113 3300005459 Bacteria 51348
15 Ga0068853_100557556 3300005539 Bacteria 1086
16 Ga0070686_100122554 3300005544 Unclassified 1787
17 Ga0070704_100058954 3300005549 Bacteria 2737
18 Ga0068855_100001401 3300005563 Bacteria 29882
19 Ga0070664_100001878 3300005564 Bacteria 16855
20 Ga0068856_100187644 3300005614 Bacteria 2081
21 Ga0068859_100000010 3300005617 Bacteria 311529
22 Ga0068860_100001981 3300005843 Bacteria 21646
23 Ga0068862_100064659 3300005844 Bacteria 3149
24 Ga0075433_10205400 3300006852 Bacteria 1751
25 Ga0075436_100000257 3300006914 Bacteria 33207
26 Ga0097620_100000010 3300006931 Bacteria 311529
27 Ga0075435_100036354 3300007076 Bacteria 3913
28 Ga0105243_10000336 3300009148 Bacteria 51356
29 Ga0157375_10217133 3300013308 Bacteria 2070
30 Ga0157376_10014598 3300014969 Bacteria 5901
31 Ga0207699_10000111 3300025906 Bacteria 57717
32 Ga0207649_10042089 3300025920 Bacteria 2784
33 Ga0207681_10256833 3300025923 Bacteria 1367
34 Ga0207687_10333929 3300025927 Bacteria 1230
35 Ga0207709_10000328 3300025935 Bacteria 51364
36 Ga0207691_10279346 3300025940 Bacteria 1437
37 Ga0207689_10204808 3300025942 Bacteria 1629
38 Ga0207679_10020502 3300025945 Bacteria 4462
39 Ga0207667_10001668 3300025949 Bacteria 27972
40 Ga0207658_10015449 3300025986 Bacteria 5238
41 Ga0207703_10069925 3300026035 Bacteria 2896
42 Ga0207639_10354793 3300026041 Bacteria 1311
43 Ga0207702_10002812 3300026078 Bacteria 16289
44 Ga0207648_10000339 3300026089 Bacteria 51305
45 Ga0268264_10004043 3300028381 Bacteria 12553
46 Ga0265318_10040478 3300028577 Bacteria 1774
47 Ga0265332_10063690 3300031238 Unclassified 1575
48 Ga0265339_10000198 3300031249 Bacteria 49802
49 Ga0265331_10073896 3300031250 Unclassified 1591
50 Ga0307508_10053729 3300031616 Bacteria 3574
51 Ga0316579_10084964 3300031691 Bacteria 1509
52 Ga0265314_10000494 3300031711 Bacteria 51177
53 Ga0316583_10008530 3300032133 Bacteria 3696
54 Ga0316583_10023840 3300032133 Bacteria 2184
55 Ga0373928_0002361 3300035084 Bacteria 3667
56 Ga0373955_0186566 3300035172 Bacteria 1232
57 Ga0373961_0000357 3300035241 Bacteria 19684
58 Ga0373935_0032293 3300035692 Bacteria 3253
59 Ga0316582_0162032 3300036647 Bacteria 1515
60 Ga0395899_0134996 3300037312 Bacteria 1759
61 Ga0316581_0026096 3300037588 Bacteria 1741
62 Ga0451577_0000176 3300042876 Bacteria 141176
63 Ga0451577_0000414 3300042876 Bacteria 77382
64 Ga0451577_0002563 3300042876 Bacteria 21451
65 Ga0451577_0010600 3300042876 Bacteria 8790
66 Ga0451577_0014903 3300042876 Bacteria 7242
67 Ga0451577_0040888 3300042876 Bacteria 4162
68 Ga0451577_0100245 3300042876 Bacteria 2587
69 Ga0451577_0137391 3300042876 Bacteria 2195
70 Ga0451577_0146663 3300042876 Bacteria 2122
71 Ga0451577_0203064 3300042876 Unclassified 1789
72 Ga0451577_0371581 3300042876 Bacteria 1297
73 Ga0451577_0563779 3300042876 Bacteria 1034
74 Ga0453683_0000001 3300044673 Bacteria 1384965
75 Ga0453683_0000014 3300044673 Bacteria 364381
76 Ga0453683_0000018 3300044673 Bacteria 309212
77 Ga0453683_0000528 3300044673 Bacteria 42795
78 Ga0453683_0000819 3300044673 Bacteria 30332
79 Ga0453683_0002573 3300044673 Bacteria 13977
80 Ga0453683_0006599 3300044673 Bacteria 7947
81 Ga0453683_0091197 3300044673 Bacteria 1910
82 Ga0453684_0000209 3300044712 Bacteria 255543
83 Ga0453684_0000551 3300044712 Bacteria 141549
84 Ga0453684_0001247 3300044712 Bacteria 77038
85 Ga0453684_0001302 3300044712 Bacteria 74077
86 Ga0453684_0001787 3300044712 Bacteria 57261
87 Ga0453684_0003548 3300044712 Bacteria 34883
88 Ga0453684_0004532 3300044712 Bacteria 29141
89 Ga0453684_0005544 3300044712 Bacteria 24909
90 Ga0453684_0013891 3300044712 Bacteria 12989
91 Ga0453684_0053039 3300044712 Bacteria 5296
92 Ga0453684_0061512 3300044712 Bacteria 4819
93 Ga0453684_0080451 3300044712 Bacteria 4068
94 Ga0453684_0090368 3300044712 Bacteria 3784
95 Ga0453684_0134893 3300044712 Bacteria 2957
96 Ga0453684_0160720 3300044712 Bacteria 2657
97 Ga0453684_0198778 3300044712 Bacteria 2338
98 Ga0453684_0338904 3300044712 Bacteria 1698
99 Ga0451576_0000271 3300045051 Bacteria 126815
100 Ga0451576_0014714 3300045051 Bacteria 8699
101 Ga0451576_0022449 3300045051 Bacteria 6843
102 Ga0451576_0110405 3300045051 Bacteria 2862
103 Ga0451576_0112752 3300045051 Bacteria 2830
104 Ga0451576_0186028 3300045051 Bacteria 2169
105 Ga0451576_0197276 3300045051 Bacteria 2103
106 Ga0451576_0293463 3300045051 Bacteria 1700
107 Ga0451576_0351816 3300045051 Bacteria 1542
108 Ga0496104_0349578 3300048907 Bacteria 1391
109 Ga0496114_0000040 3300048917 Bacteria 137465
110 Ga0496125_0256231 3300048928 Bacteria 1100
111 Ga0501075_0004337 3300049591 Bacteria 9598
112 Ga0501077_0001147 3300049593 Bacteria 16008
113 Ga0501080_0128895 3300049742 Bacteria 2342
114 nmdc:mga0rr50_8789_c1 3300050513 Bacteria 6303
115 nmdc:mga08x19_221_c1 3300050514 Bacteria 43445
116 Ga0501082_0000411 3300060353 Bacteria 37889
117 Ga0451576_0103365
118 JGI24746J21847_1000286
119 rootH1_10029717
120 rootH1_10224799
121 Ga0065707_10001952
122 Ga0065707_10087787
123 Ga0070676_10032594
124 Ga0070670_100235201
125 Ga0068869_100241892
126 Ga0070666_10000726
127 Ga0070661_100005313
128 Ga0070667_100026343
129 Ga0070709_10000490
130 Ga0068867_100000113
131 Ga0068853_100557556
132 Ga0070686_100122554
133 Ga0070704_100058954
134 Ga0068855_100001401
135 Ga0070664_100001878
136 Ga0068856_100187644
137 Ga0068859_100000010
138 Ga0068860_100001981
139 Ga0068862_100064659
140 Ga0075433_10205400
141 Ga0075436_100000257
142 Ga0097620_100000010
143 Ga0075435_100036354
144 Ga0105243_10000336
145 Ga0157375_10217133
146 Ga0157376_10014598
147 Ga0207699_10000111
148 Ga0207649_10042089
149 Ga0207681_10256833
150 Ga0207687_10333929
151 Ga0207709_10000328
152 Ga0207691_10279346
153 Ga0207689_10204808
154 Ga0207679_10020502
155 Ga0207667_10001668
156 Ga0207658_10015449
157 Ga0207703_10069925
158 Ga0207639_10354793
159 Ga0207702_10002812
160 Ga0207648_10000339
161 Ga0268264_10004043
162 Ga0265318_10040478
163 Ga0265332_10063690
164 Ga0265339_10000198
165 Ga0265331_10073896
166 Ga0307508_10053729
167 Ga0316579_10084964
168 Ga0265314_10000494
169 Ga0316583_10008530
170 Ga0316583_10023840
171 Ga0373928_0002361
172 Ga0373955_0186566
173 Ga0373961_0000357
174 Ga0373935_0032293
175 Ga0316582_0162032
176 Ga0395899_0134996
177 Ga0316581_0026096
178 Ga0451577_0000176
179 Ga0451577_0000414
180 Ga0451577_0002563
181 Ga0451577_0010600
182 Ga0451577_0014903
183 Ga0451577_0040888
184 Ga0451577_0100245
185 Ga0451577_0137391
186 Ga0451577_0146663
187 Ga0451577_0203064
188 Ga0451577_0371581
189 Ga0451577_0563779
190 Ga0453683_0000001
191 Ga0453683_0000014
192 Ga0453683_0000018
193 Ga0453683_0000528
194 Ga0453683_0000819
195 Ga0453683_0002573
196 Ga0453683_0006599
197 Ga0453683_0091197
198 Ga0453684_0000209
199 Ga0453684_0000551
200 Ga0453684_0001247
201 Ga0453684_0001302
202 Ga0453684_0001787
203 Ga0453684_0003548
204 Ga0453684_0004532
205 Ga0453684_0005544
206 Ga0453684_0013891
207 Ga0453684_0053039
208 Ga0453684_0061512
209 Ga0453684_0080451
210 Ga0453684_0090368
211 Ga0453684_0134893
212 Ga0453684_0160720
213 Ga0453684_0198778
214 Ga0453684_0338904
215 Ga0451576_0000271
216 Ga0451576_0014714
217 Ga0451576_0022449
218 Ga0451576_0110405
219 Ga0451576_0112752
220 Ga0451576_0186028
221 Ga0451576_0197276
222 Ga0451576_0293463
223 Ga0451576_0351816
224 Ga0496104_0349578
225 Ga0496114_0000040
226 Ga0496125_0256231
227 Ga0501075_0004337
228 Ga0501077_0001147
229 Ga0501080_0128895
230 nmdc:mga0rr50_8789_c1
231 nmdc:mga08x19_221_c1
232 Ga0501082_0000411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

54

230

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t0j-assembly1.cif.gz_A salmonella typhimurium arnd 0.9121 3 298
8t0j-assembly1.cif.gz_A salmonella typhimurium arnd 0.8928 3 298
4m1b-assembly2.cif.gz_B structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis 0.8524 5 270
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.8459 2 268
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.8451 2 268
ID Description Score Start End Superfamily
3dlbB04 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8636 121 151 3.30.420.10
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8524 5 270 3.20.20.370
af_P76472_1_267_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8483 3 267 3.30.70.260
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8447 2 267 3.20.20.370
af_P76472_1_267_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8362 3 267 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A2T6D884-F1-model_v4 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase 0.9974 25 300 GO:0005975
GO:0016810
AF-A0A1F7SGR3-F1-model_v4 NodB homology domain-containing protein 0.9928 5 300 GO:0005975
GO:0016810
AF-A0A359LEK4-F1-model_v4 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase 0.9922 1 253 GO:0005975
GO:0016810
AF-A0A2T6D884-F1-model_v4 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase 0.9903 25 300 GO:0005975
GO:0016810
AF-R7LC88-F1-model_v4 Polysaccharide deacetylase 0.9889 5 301 GO:0005975
GO:0016810

Map