F089765

General Info

Members Datasets Scaffolds Average Seq Length
116 97 232 388

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0000359|Ga0495634_0000359_11970_13178
Length 377
Sequence MRRRLRAGLLLISLAGAGRRIALKRIGSFDNPVYVTGAPGAPRLLFVVEQGGKVVVLRDGHRLRRPFLDISGLVSFEGERGLLSIAFPPDYGRSGRFYAYYTDNQGNIRIDEFHRRSQTRAARGSRRQVILIPHPFNSNHNGGQMQFLGGLLYFGTGDGGSAGDPPNNAQNKNVLLGKMLRIDPRPSGGRPYSIPASNPFAGPTAGRGEIYSYGLRNPFRFSFDTAGTGAPRIAIGDVGQNRFEELDYTTVRAASGANFGWDALEGFAPYREENGGTPDPGGTTKPIFAYTHSRDGSCTIIGGYVSRDPRLPSLRGRYIYADYCEGKLRSLLPRLGGAKGDHLLGLSVESPTSFGEDDRGRLYVTSQAGPVFRLVPR

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
56 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
57 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
58 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
61 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
62 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
63 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
64 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
65 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
66 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
69 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
70 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
71 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
72 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
73 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
74 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
75 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
93 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
94 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
95 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
96 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
97 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 12.93
Rhizosphere 84.48
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0000359 3300046642 Bacteria 44267
2 JGI25404J52841_10000300 3300003659 Bacteria 6462
3 Ga0070682_100000009 3300005337 Bacteria 291635
4 Ga0070689_100055170 3300005340 Bacteria 3078
5 Ga0070671_100061144 3300005355 Bacteria 3136
6 Ga0070673_100007106 3300005364 Bacteria 7354
7 Ga0070688_100005492 3300005365 Bacteria 6682
8 Ga0070688_100086053 3300005365 Unclassified 2044
9 Ga0070713_100000239 3300005436 Bacteria 36304
10 Ga0070711_100100315 3300005439 Unclassified 2105
11 Ga0070685_10005058 3300005466 Bacteria 6685
12 Ga0068856_100026405 3300005614 Bacteria 5663
13 Ga0068852_100000024 3300005616 Bacteria 120479
14 Ga0068863_100000050 3300005841 Bacteria 130200
15 Ga0068860_100050004 3300005843 Bacteria 3981
16 Ga0081540_1000545 3300005983 Bacteria 36477
17 Ga0068865_100000024 3300006881 Bacteria 94969
18 Ga0105245_10014841 3300009098 Bacteria 6785
19 Ga0105242_10000421 3300009176 Bacteria 33769
20 Ga0105242_10117242 3300009176 Bacteria 2279
21 Ga0105249_10000054 3300009553 Bacteria 162883
22 Ga0157370_10035743 3300013104 Bacteria 4826
23 Ga0157369_10000068 3300013105 Bacteria 144274
24 Ga0157378_10026341 3300013297 Bacteria 5126
25 Ga0207710_10000356 3300025900 Bacteria 32450
26 Ga0207687_10000025 3300025927 Bacteria 175177
27 Ga0207687_10000109 3300025927 Bacteria 59406
28 Ga0207700_10000019 3300025928 Bacteria 183117
29 Ga0207690_10017980 3300025932 Bacteria 4329
30 Ga0207686_10000416 3300025934 Bacteria 29091
31 Ga0207670_10084316 3300025936 Unclassified 2231
32 Ga0207704_10000054 3300025938 Bacteria 79155
33 Ga0207651_10002955 3300025960 Bacteria 8220
34 Ga0207712_10000032 3300025961 Bacteria 210628
35 Ga0207668_10035910 3300025972 Bacteria 3305
36 Ga0207639_10100943 3300026041 Bacteria 2332
37 Ga0207702_10013553 3300026078 Bacteria 6772
38 Ga0207641_10000436 3300026088 Bacteria 47925
39 Ga0207698_10000014 3300026142 Bacteria 240703
40 Ga0268264_10040267 3300028381 Bacteria 3861
41 Ga0265337_1000060 3300028556 Bacteria 49697
42 Ga0265326_10000056 3300028558 Bacteria 64840
43 Ga0265319_1000037 3300028563 Bacteria 115642
44 Ga0265322_10000017 3300028654 Bacteria 114833
45 Ga0265338_10000051 3300028800 Bacteria 211202
46 Ga0265324_10000196 3300029957 Bacteria 46096
47 Ga0265320_10000068 3300031240 Bacteria 91884
48 Ga0265325_10082959 3300031241 Bacteria 1590
49 Ga0265329_10005649 3300031242 Bacteria 5031
50 Ga0265331_10001724 3300031250 Bacteria 15748
51 Ga0265327_10000317 3300031251 Bacteria 92215
52 Ga0265314_10000441 3300031711 Bacteria 55548
53 Ga0265342_10099013 3300031712 Bacteria 1663
54 Ga0451853_3195697 3300041512 Bacteria 2452
55 Ga0466963_0002221 3300044694 Bacteria 10750
56 Ga0466963_0109215 3300044694 Unclassified 1897
57 Ga0466967_0069493 3300045976 Bacteria 3148
58 Ga0495629_0001594 3300046459 Bacteria 17849
59 Ga0495629_0001912 3300046459 Bacteria 16225
60 Ga0495594_0000001 3300046499 Bacteria 293051
61 Ga0495608_0000042 3300046511 Bacteria 115906
62 Ga0495628_0000628 3300046516 Bacteria 32247
63 Ga0495630_0034995 3300046517 Bacteria 3752
64 Ga0495630_0058898 3300046517 Bacteria 2880
65 Ga0495652_0000009 3300046529 Bacteria 311000
66 Ga0495587_0066499 3300046536 Bacteria 2102
67 Ga0495622_0000033 3300046557 Bacteria 124162
68 Ga0495667_0000019 3300046559 Bacteria 181645
69 Ga0495635_0019618 3300046663 Bacteria 4710
70 Ga0495657_0000040 3300046675 Bacteria 115899
71 Ga0495658_0002027 3300046683 Bacteria 10310
72 Ga0495658_0099233 3300046683 Bacteria 1736
73 Ga0495669_0000420 3300046684 Bacteria 20393
74 Ga0495613_0002048 3300046689 Bacteria 15327
75 Ga0495600_0018413 3300046809 Bacteria 4450
76 Ga0495604_0005169 3300047317 Bacteria 10334
77 Ga0495604_0052041 3300047317 Bacteria 3173
78 Ga0495674_0000589 3300047319 Bacteria 34001
79 Ga0495676_0035371 3300047321 Bacteria 4179
80 Ga0495680_0001728 3300047322 Bacteria 23182
81 Ga0495680_0005339 3300047322 Bacteria 12122
82 Ga0495680_0042253 3300047322 Bacteria 3619
83 Ga0495675_0000051 3300047444 Bacteria 80375
84 Ga0495675_0036058 3300047444 Bacteria 3156
85 Ga0495686_0031062 3300047472 Bacteria 3466
86 Ga0495593_0026372 3300047673 Bacteria 3209
87 Ga0495602_0000038 3300048088 Bacteria 130758
88 Ga0495602_0005333 3300048088 Bacteria 13494
89 Ga0496100_0000028 3300048903 Bacteria 113912
90 Ga0496101_0000005 3300048904 Bacteria 331455
91 Ga0496102_0000021 3300048905 Bacteria 246920
92 Ga0496103_0000001 3300048906 Bacteria 643471
93 Ga0496104_0060459 3300048907 Bacteria 3589
94 Ga0496105_0000003 3300048908 Bacteria 713251
95 Ga0496105_0022502 3300048908 Bacteria 5105
96 Ga0496106_0000033 3300048909 Bacteria 131412
97 Ga0496107_0000004 3300048910 Bacteria 297680
98 Ga0496108_0000042 3300048911 Bacteria 146397
99 Ga0496109_0000034 3300048912 Bacteria 160397
100 Ga0496112_0000002 3300048915 Bacteria 782039
101 Ga0496114_0000003 3300048917 Bacteria 630981
102 Ga0496115_0000005 3300048918 Bacteria 290756
103 Ga0496115_0000036 3300048918 Bacteria 127774
104 Ga0501070_0040621 3300049586 Bacteria 3879
105 nmdc:mga0rr50_50888_c1 3300050513 Bacteria 3071
106 Ga0495601_0013930 3300053077 Bacteria 4842
107 Ga0495655_0000008 3300053083 Bacteria 153535
108 Ga0495655_0005044 3300053083 Bacteria 2304
109 Ga0495595_0000009 3300053084 Bacteria 193039
110 Ga0495595_0008609 3300053084 Bacteria 4196
111 Ga0495619_0000057 3300053085 Bacteria 93948
112 Ga0495619_0000119 3300053085 Bacteria 58302
113 Ga0495619_0002467 3300053085 Bacteria 12097
114 Ga0495619_0017622 3300053085 Bacteria 4524
115 Ga0500566_0001814 3300053094 Bacteria 12548
116 Ga0500628_000023 3300053129 Bacteria 77818
117 Ga0495634_0000359
118 JGI25404J52841_10000300
119 Ga0070682_100000009
120 Ga0070689_100055170
121 Ga0070671_100061144
122 Ga0070673_100007106
123 Ga0070688_100005492
124 Ga0070688_100086053
125 Ga0070713_100000239
126 Ga0070711_100100315
127 Ga0070685_10005058
128 Ga0068856_100026405
129 Ga0068852_100000024
130 Ga0068863_100000050
131 Ga0068860_100050004
132 Ga0081540_1000545
133 Ga0068865_100000024
134 Ga0105245_10014841
135 Ga0105242_10000421
136 Ga0105242_10117242
137 Ga0105249_10000054
138 Ga0157370_10035743
139 Ga0157369_10000068
140 Ga0157378_10026341
141 Ga0207710_10000356
142 Ga0207687_10000025
143 Ga0207687_10000109
144 Ga0207700_10000019
145 Ga0207690_10017980
146 Ga0207686_10000416
147 Ga0207670_10084316
148 Ga0207704_10000054
149 Ga0207651_10002955
150 Ga0207712_10000032
151 Ga0207668_10035910
152 Ga0207639_10100943
153 Ga0207702_10013553
154 Ga0207641_10000436
155 Ga0207698_10000014
156 Ga0268264_10040267
157 Ga0265337_1000060
158 Ga0265326_10000056
159 Ga0265319_1000037
160 Ga0265322_10000017
161 Ga0265338_10000051
162 Ga0265324_10000196
163 Ga0265320_10000068
164 Ga0265325_10082959
165 Ga0265329_10005649
166 Ga0265331_10001724
167 Ga0265327_10000317
168 Ga0265314_10000441
169 Ga0265342_10099013
170 Ga0451853_3195697
171 Ga0466963_0002221
172 Ga0466963_0109215
173 Ga0466967_0069493
174 Ga0495629_0001594
175 Ga0495629_0001912
176 Ga0495594_0000001
177 Ga0495608_0000042
178 Ga0495628_0000628
179 Ga0495630_0034995
180 Ga0495630_0058898
181 Ga0495652_0000009
182 Ga0495587_0066499
183 Ga0495622_0000033
184 Ga0495667_0000019
185 Ga0495635_0019618
186 Ga0495657_0000040
187 Ga0495658_0002027
188 Ga0495658_0099233
189 Ga0495669_0000420
190 Ga0495613_0002048
191 Ga0495600_0018413
192 Ga0495604_0005169
193 Ga0495604_0052041
194 Ga0495674_0000589
195 Ga0495676_0035371
196 Ga0495680_0001728
197 Ga0495680_0005339
198 Ga0495680_0042253
199 Ga0495675_0000051
200 Ga0495675_0036058
201 Ga0495686_0031062
202 Ga0495593_0026372
203 Ga0495602_0000038
204 Ga0495602_0005333
205 Ga0496100_0000028
206 Ga0496101_0000005
207 Ga0496102_0000021
208 Ga0496103_0000001
209 Ga0496104_0060459
210 Ga0496105_0000003
211 Ga0496105_0022502
212 Ga0496106_0000033
213 Ga0496107_0000004
214 Ga0496108_0000042
215 Ga0496109_0000034
216 Ga0496112_0000002
217 Ga0496114_0000003
218 Ga0496115_0000005
219 Ga0496115_0000036
220 Ga0501070_0040621
221 nmdc:mga0rr50_50888_c1
222 Ga0495601_0013930
223 Ga0495655_0000008
224 Ga0495655_0005044
225 Ga0495595_0000009
226 Ga0495595_0008609
227 Ga0495619_0000057
228 Ga0495619_0000119
229 Ga0495619_0002467
230 Ga0495619_0017622
231 Ga0500566_0001814
232 Ga0500628_000023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

29

331

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7845 36 391
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.7819 37 387
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7718 36 391
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.7688 37 387
2ism-assembly1.cif.gz_A crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8 0.7642 36 389
ID Description Score Start End Superfamily
af_Q14DK5_187_578_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8105 38 387 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7668 36 391 2.120.10.30
af_Q2QLJ8_215_613_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7653 46 363 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7631 36 389 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7589 36 389 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7V9T5A7-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9401 39 199
AF-A0A3B0S8I4-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.936 39 128
AF-A0A4Q2Y730-F1-model_v4 Glucose dehydrogenase 0.9346 39 163
AF-A0A3N5M790-F1-model_v4 Glucose dehydrogenase 0.9294 39 192
AF-A0A7V4U1X3-F1-model_v4 Glucose sorbosone dehydrogenase 0.9045 44 198

Map