F089945

General Info

Members Datasets Scaffolds Average Seq Length
116 89 232 450

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0002003|Ga0496117_0002003_21861_23438
Length 525
Sequence MRIVAASSHTTGKSYTSTRYPILNETGEIPRIRRISGSMTTQAGGKAACPVSTQIHLARFLQHDGKGAAMVTRRSFLSGLALGAAGAATDARAQTQRVPVLDVDLRGSIDAAAHGIRPGAGDRKSKAFAKLLKDAAAKNMPVFLPPGDYVISNLTLPDNTRLTGVPGATRIVYGGDGHLFAADGAARIELANLVIDGANRWLDDTVQGLLHVSAVANLTIENCEIQGSAKSAIYMERSGGRIERSRISGAADHAIHAVESQTLSVTGNQVFDCGNGGILIHRWQAGRDGSIVSGNRIARISATRGGTGQYGNGINIFRADDVMITNNHVSGCAFSAIRANAGSNVQISGNTCLDSGETAIYSEFGFTGAVVNGNLVDGAANGILIVNFNEGGRLATVTGNVVRNLKLDGPYIHEGAGFXXXIAVEADTVLSGNTVENAPKWGLVLGWGPYMRGLVVNGNLVRNSPVGCAVSVVEGAGSALISGNIFEETRTAAIAGFRWNERTTDDLATASESYPHLTIERNRTG

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
10 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
11 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
12 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
13 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
14 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
15 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
16 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
17 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
22 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
23 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
24 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
27 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
28 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
29 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
30 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
31 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
32 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
33 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
34 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
35 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
36 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
37 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
38 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
39 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
40 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
41 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
42 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
45 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
46 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
49 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
50 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
51 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
54 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
55 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
56 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
57 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
58 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
59 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
60 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
61 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
62 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
63 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
64 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
65 2643221558 Rhizobium sp. Root149 Isolate Unclassified
66 2643221607 Rhizobium sp. Root73 Isolate Unclassified
67 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
68 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
69 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
70 2643221688 Rhizobium sp. Root482 Isolate Unclassified
71 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
72 2643221718 Rhizobium sp. Root268 Isolate Unclassified
73 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
74 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
75 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
76 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
77 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
78 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
79 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
80 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
81 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
82 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
83 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
84 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
85 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
86 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
87 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
88 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
89 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.28
Metatranscriptomes 0
Isolates 26.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 1.72
Rhizoplane 2.59
Rhizosphere 43.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0002003 3300048920 Bacteria 26991
2 JGI25162J39368_1001679 3300002737 Bacteria 10846
3 JGI25165J46597_1001245 3300003214 Bacteria 15077
4 Ga0055526_1006209 3300003771 Bacteria 6560
5 Ga0055524_1005812 3300003775 Bacteria 5448
6 Ga0055524_1005992 3300003775 Bacteria 5341
7 Ga0055528_1000092 3300003790 Bacteria 71565
8 Ga0065165_1004594 3300005262 Bacteria 8409
9 Ga0075365_10103232 3300006038 Bacteria 1954
10 Ga0209760_101744 3300025207 Bacteria 2190
11 Ga0209437_100033 3300025233 Bacteria 512520
12 Ga0209129_1002582 3300025258 Bacteria 8699
13 Ga0209233_1000152 3300025261 Bacteria 175910
14 Ga0209673_1000169 3300025273 Bacteria 134216
15 Ga0209673_1011472 3300025273 Bacteria 3650
16 Ga0209025_1000118 3300025294 Bacteria 214009
17 Ga0209025_1039179 3300025294 Bacteria 2071
18 Ga0209564_1000286 3300025295 Bacteria 102405
19 Ga0209758_1000486 3300025297 Bacteria 65083
20 Ga0209758_1021463 3300025297 Bacteria 3009
21 Ga0209256_1001031 3300025299 Bacteria 32723
22 Ga0209256_1004455 3300025299 Bacteria 8783
23 Ga0207426_1002467 3300025302 Bacteria 11771
24 Ga0265318_10033466 3300028577 Bacteria 1984
25 Ga0307515_10000420 3300028794 Bacteria 102216
26 Ga0307515_10010804 3300028794 Bacteria 17421
27 Ga0307515_10080612 3300028794 Bacteria 4242
28 Ga0265325_10021220 3300031241 Bacteria 3573
29 Ga0265340_10001720 3300031247 Bacteria 12552
30 Ga0265340_10035353 3300031247 Bacteria 2481
31 Ga0265339_10003158 3300031249 Bacteria 11595
32 Ga0265339_10049794 3300031249 Bacteria 2293
33 Ga0265316_10008968 3300031344 Bacteria 9222
34 Ga0307513_10004495 3300031456 Bacteria 18608
35 Ga0265313_10000031 3300031595 Bacteria 128981
36 Ga0265314_10024179 3300031711 Bacteria 4611
37 Ga0395905_0003119 3300037471 Bacteria 17874
38 Ga0395905_0009095 3300037471 Bacteria 9737
39 Ga0395905_0083248 3300037471 Bacteria 2997
40 Ga0495654_0000134 3300046530 Bacteria 77701
41 Ga0496110_0095912 3300048913 Bacteria 2657
42 Ga0496111_0007482 3300048914 Bacteria 7162
43 Ga0496122_0000604 3300048925 Bacteria 73844
44 Ga0496123_0001019 3300048926 Bacteria 42794
45 Ga0496124_0004057 3300048927 Bacteria 17366
46 Ga0496124_0062034 3300048927 Bacteria 3130
47 Ga0496125_0002201 3300048928 Bacteria 26004
48 Ga0496126_0006318 3300048929 Bacteria 13229
49 Ga0496126_0010199 3300048929 Bacteria 9881
50 Ga0496126_0270845 3300048929 Bacteria 1409
51 Ga0501031_0000321 3300049568 Bacteria 27495
52 Ga0501031_0009373 3300049568 Bacteria 6364
53 Ga0501032_0000008 3300049569 Bacteria 240313
54 Ga0501032_0051330 3300049569 Bacteria 2781
55 Ga0501033_0000012 3300049570 Bacteria 241599
56 Ga0501033_0063446 3300049570 Bacteria 2719
57 Ga0501033_0111474 3300049570 Bacteria 1991
58 Ga0501034_0000035 3300049571 Bacteria 241623
59 Ga0501034_0062288 3300049571 Bacteria 3746
60 Ga0501036_0000006 3300049572 Bacteria 241623
61 Ga0501037_0000072 3300049573 Bacteria 94452
62 Ga0501038_0000007 3300049574 Bacteria 210775
63 Ga0501038_0051432 3300049574 Bacteria 3555
64 Ga0501039_0000012 3300049575 Bacteria 241623
65 Ga0501040_0001880 3300049576 Bacteria 13465
66 Ga0501043_0000211 3300049579 Bacteria 53464
67 Ga0501046_0028772 3300049580 Bacteria 4522
68 Ga0501047_0000380 3300049581 Bacteria 50128
69 Ga0501047_0135718 3300049581 Bacteria 2341
70 Ga0501047_0237652 3300049581 Bacteria 1673
71 Ga0501047_0300915 3300049581 Bacteria 1446
72 Ga0501070_0012989 3300049586 Bacteria 7020
73 Ga0501073_0126399 3300049589 Bacteria 1772
74 Ga0501035_0000035 3300049822 Bacteria 166916
75 Ga0501035_0011819 3300049822 Bacteria 8085
76 Ga0501035_0043096 3300049822 Bacteria 4068
77 Ga0501044_0000015 3300049823 Bacteria 241623
78 Ga0501045_0100150 3300049824 Bacteria 2145
79 nmdc:mga0yw44_523_c1 3300050492 Bacteria 13755
80 nmdc:mga0yw44_76064_c1 3300050492 Bacteria 2094
81 Ga0500618_000007 3300053125 Bacteria 226268
82 Ga0500658_0000863 3300053134 Bacteria 12435
83 Ga0500573_0000906 3300053140 Bacteria 13462
84 Ga0500573_0029465 3300053140 Bacteria 3163
85 Ga0500616_0000120 3300053153 Bacteria 142980
86 2510840174 2510461069 Bacteria 5505000
87 2585165317 2582581283 Bacteria 6030556
88 2585266454 2582581306 Bacteria 6450535
89 2585387432 2582581865 Bacteria 6644329
90 2585394092 2582581866 Bacteria 6859583
91 2600374992 2600254933 Bacteria 4750527
92 2643810260 2643221558 Bacteria 5460675
93 2644046811 2643221607 Bacteria 6314006
94 2644202518 2643221636 Bacteria 6583769
95 2644206419 2643221637 Bacteria 5345260
96 2644479600 2643221686 Bacteria 6310811
97 2644493592 2643221688 Bacteria 5260751
98 2644500747 2643221689 Bacteria 6042950
99 2644650066 2643221718 Bacteria 5345506
100 2738945903 2738541317 Bacteria 5340176
101 2776912489 2775507049 Bacteria 6284736
102 2819242854 2818991272 Bacteria 4622173
103 2819684377 2818991461 Bacteria 7026071
104 2842525101 2842521101 Bacteria 6569494
105 2854898583 2854896431 Bacteria 5869725
106 2854921817 2854916844 Bacteria 5725939
107 2891376444 2891373044 Bacteria 5202277
108 2894655098 2894652903 Bacteria 4587256
109 2899806083 2899803654 Bacteria 5577784
110 2913310412 2913308742 Bacteria 5350706
111 2917557699 2917554339 Bacteria 4987857
112 2989355179 2989349275 Bacteria 6349068
113 2989775401 2989771324 Bacteria 5605128
114 3003932389 3003930520 Bacteria 5667563
115 8054560056 8054558443 Bacteria 5204801
116 8056879399 8056875544 Bacteria 4355797
117 Ga0496117_0002003
118 JGI25162J39368_1001679
119 JGI25165J46597_1001245
120 Ga0055526_1006209
121 Ga0055524_1005812
122 Ga0055524_1005992
123 Ga0055528_1000092
124 Ga0065165_1004594
125 Ga0075365_10103232
126 Ga0209760_101744
127 Ga0209437_100033
128 Ga0209129_1002582
129 Ga0209233_1000152
130 Ga0209673_1000169
131 Ga0209673_1011472
132 Ga0209025_1000118
133 Ga0209025_1039179
134 Ga0209564_1000286
135 Ga0209758_1000486
136 Ga0209758_1021463
137 Ga0209256_1001031
138 Ga0209256_1004455
139 Ga0207426_1002467
140 Ga0265318_10033466
141 Ga0307515_10000420
142 Ga0307515_10010804
143 Ga0307515_10080612
144 Ga0265325_10021220
145 Ga0265340_10001720
146 Ga0265340_10035353
147 Ga0265339_10003158
148 Ga0265339_10049794
149 Ga0265316_10008968
150 Ga0307513_10004495
151 Ga0265313_10000031
152 Ga0265314_10024179
153 Ga0395905_0003119
154 Ga0395905_0009095
155 Ga0395905_0083248
156 Ga0495654_0000134
157 Ga0496110_0095912
158 Ga0496111_0007482
159 Ga0496122_0000604
160 Ga0496123_0001019
161 Ga0496124_0004057
162 Ga0496124_0062034
163 Ga0496125_0002201
164 Ga0496126_0006318
165 Ga0496126_0010199
166 Ga0496126_0270845
167 Ga0501031_0000321
168 Ga0501031_0009373
169 Ga0501032_0000008
170 Ga0501032_0051330
171 Ga0501033_0000012
172 Ga0501033_0063446
173 Ga0501033_0111474
174 Ga0501034_0000035
175 Ga0501034_0062288
176 Ga0501036_0000006
177 Ga0501037_0000072
178 Ga0501038_0000007
179 Ga0501038_0051432
180 Ga0501039_0000012
181 Ga0501040_0001880
182 Ga0501043_0000211
183 Ga0501046_0028772
184 Ga0501047_0000380
185 Ga0501047_0135718
186 Ga0501047_0237652
187 Ga0501047_0300915
188 Ga0501070_0012989
189 Ga0501073_0126399
190 Ga0501035_0000035
191 Ga0501035_0011819
192 Ga0501035_0043096
193 Ga0501044_0000015
194 Ga0501045_0100150
195 nmdc:mga0yw44_523_c1
196 nmdc:mga0yw44_76064_c1
197 Ga0500618_000007
198 Ga0500658_0000863
199 Ga0500573_0000906
200 Ga0500573_0029465
201 Ga0500616_0000120
202 2510840174
203 2585165317
204 2585266454
205 2585387432
206 2585394092
207 2600374992
208 2643810260
209 2644046811
210 2644202518
211 2644206419
212 2644479600
213 2644493592
214 2644500747
215 2644650066
216 2738945903
217 2776912489
218 2819242854
219 2819684377
220 2842525101
221 2854898583
222 2854921817
223 2891376444
224 2894655098
225 2899806083
226 2913310412
227 2917557699
228 2989355179
229 2989775401
230 3003932389
231 8054560056
232 8056879399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13229

Beta_helix

Right handed beta helix region

284

402

0.85

PF05048

NosD

Periplasmic copper-binding protein (NosD)

288

516

0.81

PF13229

Beta_helix

Right handed beta helix region

177

308

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eea-assembly1.cif.gz_C cyanophage pam1 tailspike receptor-binding domain 0.6355 30 416
7c7d-assembly2.cif.gz_B crystal structure of the catalytic unit of thermostable gh87 alpha-1,3-glucanase from streptomyces thermodiastaticus strain hf3-3 0.617 39 438
3gq7-assembly1.cif.gz_A crystal structure of the bacteriophage phi29 gene product 12 n-terminal fragment 0.6139 41 412
7eea-assembly1.cif.gz_B cyanophage pam1 tailspike receptor-binding domain 0.6071 30 412
3suc-assembly1.cif.gz_A crystal structure of the pre-mature bacteriophage phi29 gene product 12 0.6067 41 423
ID Description Score Start End Superfamily
af_Q7TPD1_723_883_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8125 156 259 3.30.40.10
af_Q9Z179_369_624_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7409 73 232 2.160.20.10
af_Q54DF3_420_605_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7315 96 327 2.160.20.10
af_A4I4X9_9_274_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6969 64 349 2.160.20.10
af_A0A0R0F0K0_135_291_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6911 38 155 2.160.20.10
ID Description Score Start End GO Terms
AF-A0A528FLY6-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9983 78 159
AF-A0A532AJ08-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9884 140 250
AF-A0A4R9VMB3-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9817 49 165
AF-A0A527GIF9-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9758 353 439
AF-A0A528FLY6-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9746 78 159

Map