F093347

General Info

Members Datasets Scaffolds Average Seq Length
117 67 234 389

Family's Representative Sequence

Representative Sequence 3300028654|Ga0265322_10010338|Ga0265322_100103382
Length 410
Sequence LTMKNISKLTHQKINKLTPEIEEAKKAALEVLLHNSHGPYNGLPRTAGWGYPEPYTRDLMFSIFGIAVSGNQKLMQSIRKVLETLAENQTERGHIPSLVHDKEDRGSSDTTPLFLLGVGIFRKVSGESKFLNEAVKKAMIWMEYQSPSDRYLIAQQPTSDWRDEQWMTGYGLFVNTLVYSYLRILGQNKRANRIRHEMGRFTITGGTIHRHVHEGLVVKHKPYYAFWSYKIHSSERFDLLGNCLAILSGLASPSRAKEIISWIEEECASMRKRGELTIDLPPNFFPFIKPEDPDWLPRYKIFNNPGDYHNGGIWPFICGFYVAALVAAKRYTLAREKLVTLTHSIKISNTGRVDFGFNEWIKAQDGKPMGQDWQTWSAALYLYAVKCVEEKRTPFFDEIRNCLTESKTEQ

Samples

Sample ID Description Type Environment
1 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
36 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
47 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
48 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
49 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
50 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
51 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
52 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
53 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
56 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
57 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
58 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
59 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
60 2738543023 Pedobacter sp. OK628 Isolate Unclassified
61 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
62 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
63 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
64 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
65 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
66 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
67 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.31
Metatranscriptomes 0
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 0
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265322_10010338 3300028654 Bacteria 2706
2 rootH2_10020698 3300003320 Bacteria 15994
3 rootH2_10092528 3300003320 Bacteria 3018
4 rootH2_10226837 3300003320 Bacteria 2695
5 rootH1_10166578 3300003323 Bacteria 2226
6 rootH1_10284542 3300003323 Bacteria 4483
7 Ga0065707_10148311 3300005295 Bacteria 1687
8 Ga0070670_100253632 3300005331 Bacteria 1533
9 Ga0070671_100023580 3300005355 Bacteria 5038
10 Ga0070708_100196069 3300005445 Bacteria 1890
11 Ga0070662_100042635 3300005457 Unclassified 3242
12 Ga0070707_100021982 3300005468 Bacteria 6031
13 Ga0070698_100031955 3300005471 Bacteria 5455
14 Ga0070699_100014223 3300005518 Bacteria 6846
15 Ga0070672_100011487 3300005543 Bacteria 6177
16 Ga0068855_100000109 3300005563 Bacteria 102724
17 Ga0068855_100001996 3300005563 Bacteria 25334
18 Ga0068856_100000031 3300005614 Bacteria 126668
19 Ga0068856_100004862 3300005614 Bacteria 13305
20 Ga0068852_100316097 3300005616 Unclassified 1515
21 Ga0105240_10180748 3300009093 Unclassified 2489
22 Ga0105243_10000007 3300009148 Bacteria 445042
23 Ga0105241_10233068 3300009174 Bacteria 1553
24 Ga0157375_10030086 3300013308 Bacteria 5115
25 Ga0182008_10031817 3300014497 Unclassified 2653
26 Ga0182007_10010975 3300015262 Bacteria 3548
27 Ga0182007_10052336 3300015262 Bacteria 1346
28 Ga0209130_1011305 3300025284 Unclassified 2397
29 Ga0207426_1000139 3300025302 Bacteria 195835
30 Ga0207684_10210990 3300025910 Bacteria 1675
31 Ga0207654_10153081 3300025911 Bacteria 1482
32 Ga0207695_10003033 3300025913 Bacteria 24099
33 Ga0207646_10168687 3300025922 Unclassified 1976
34 Ga0207644_10018977 3300025931 Unclassified 4662
35 Ga0207706_10074650 3300025933 Bacteria 2981
36 Ga0207709_10000049 3300025935 Bacteria 237124
37 Ga0207691_10016901 3300025940 Bacteria 6922
38 Ga0207667_10000154 3300025949 Bacteria 102734
39 Ga0207667_10025788 3300025949 Bacteria 6430
40 Ga0207702_10000071 3300026078 Bacteria 114394
41 Ga0265334_10020755 3300028573 Unclassified 2688
42 Ga0265334_10027109 3300028573 Bacteria 2310
43 Ga0265323_10000124 3300028653 Bacteria 43991
44 Ga0265323_10005254 3300028653 Bacteria 5504
45 Ga0265336_10005091 3300028666 Bacteria 4890
46 Ga0265338_10003408 3300028800 Bacteria 22423
47 Ga0265338_10004513 3300028800 Bacteria 18771
48 Ga0265338_10066825 3300028800 Bacteria 3109
49 Ga0265316_10000886 3300031344 Bacteria 32806
50 Ga0265316_10001403 3300031344 Bacteria 25930
51 Ga0265316_10001496 3300031344 Bacteria 25062
52 Ga0265316_10002071 3300031344 Bacteria 21095
53 Ga0307513_10050553 3300031456 Bacteria 4492
54 Ga0316576_10100650 3300031727 Bacteria 2160
55 Ga0395899_0000002 3300037312 Bacteria 1324310
56 Ga0395899_0010050 3300037312 Bacteria 7254
57 Ga0395899_0079517 3300037312 Unclassified 2388
58 Ga0395900_0012055 3300037418 Bacteria 8837
59 Ga0395898_0006559 3300037466 Bacteria 12417
60 Ga0395898_0072823 3300037466 Bacteria 3319
61 Ga0395905_0000380 3300037471 Bacteria 63103
62 Ga0395905_0002066 3300037471 Bacteria 22878
63 Ga0395901_0000271 3300038443 Bacteria 64591
64 Ga0400490_19468 3300038726 Bacteria 28884
65 Ga0451577_0000015 3300042876 Bacteria 538333
66 Ga0451577_0000034 3300042876 Bacteria 376183
67 Ga0451577_0005644 3300042876 Bacteria 12714
68 Ga0451577_0019396 3300042876 Bacteria 6254
69 Ga0451577_0026246 3300042876 Bacteria 5277
70 Ga0451577_0062328 3300042876 Bacteria 3326
71 Ga0451577_0070748 3300042876 Bacteria 3111
72 Ga0451577_0189195 3300042876 Bacteria 1857
73 Ga0451577_0348640 3300042876 Unclassified 1343
74 Ga0453683_0000015 3300044673 Bacteria 346024
75 Ga0453683_0001190 3300044673 Bacteria 23486
76 Ga0453683_0072582 3300044673 Bacteria 2154
77 Ga0453683_0120016 3300044673 Bacteria 1655
78 Ga0453683_0133463 3300044673 Unclassified 1565
79 Ga0453683_0134235 3300044673 Unclassified 1560
80 Ga0453684_0000081 3300044712 Bacteria 402985
81 Ga0453684_0000086 3300044712 Bacteria 397278
82 Ga0453684_0000098 3300044712 Bacteria 376183
83 Ga0453684_0000438 3300044712 Bacteria 169720
84 Ga0453684_0000651 3300044712 Bacteria 125123
85 Ga0453684_0001862 3300044712 Bacteria 55001
86 Ga0453684_0003480 3300044712 Bacteria 35365
87 Ga0453684_0006366 3300044712 Bacteria 22501
88 Ga0453684_0012909 3300044712 Bacteria 13684
89 Ga0453684_0033763 3300044712 Bacteria 7121
90 Ga0453684_0037001 3300044712 Bacteria 6709
91 Ga0453684_0091899 3300044712 Bacteria 3744
92 Ga0451576_0000036 3300045051 Bacteria 376183
93 Ga0451576_0000080 3300045051 Bacteria 242782
94 Ga0451576_0000718 3300045051 Bacteria 66705
95 Ga0451576_0001696 3300045051 Bacteria 36431
96 Ga0451576_0009331 3300045051 Bacteria 11387
97 Ga0451576_0047568 3300045051 Bacteria 4509
98 Ga0451576_0088669 3300045051 Bacteria 3218
99 Ga0451576_0092668 3300045051 Bacteria 3143
100 Ga0495687_000385 3300047443 Bacteria 54684
101 Ga0495687_003888 3300047443 Bacteria 10475
102 Ga0496116_0037130 3300048919 Bacteria 3400
103 Ga0496117_0015551 3300048920 Bacteria 6478
104 Ga0496118_0069723 3300048921 Bacteria 2544
105 Ga0496123_0017733 3300048926 Bacteria 5708
106 Ga0496124_0093857 3300048927 Bacteria 2442
107 Ga0496125_0102800 3300048928 Bacteria 2099
108 nmdc:mga05p37_46207_c1 3300050507 Bacteria 5354
109 2722729862 2721755487 Bacteria 6357185
110 2739301602 2738543023 Bacteria 6767879
111 2819679083 2818991460 Bacteria 7595395
112 2852627604 2852627209 Bacteria 5896285
113 2904780812 2904780799 Bacteria 5840761
114 2919180725 2919177583 Bacteria 5641607
115 2929181819 2929177148 Bacteria 7883697
116 2945984216 2945977869 Bacteria 7777518
117 2946016390 2946013367 Bacteria 7766675
118 Ga0265322_10010338
119 rootH2_10020698
120 rootH2_10092528
121 rootH2_10226837
122 rootH1_10166578
123 rootH1_10284542
124 Ga0065707_10148311
125 Ga0070670_100253632
126 Ga0070671_100023580
127 Ga0070708_100196069
128 Ga0070662_100042635
129 Ga0070707_100021982
130 Ga0070698_100031955
131 Ga0070699_100014223
132 Ga0070672_100011487
133 Ga0068855_100000109
134 Ga0068855_100001996
135 Ga0068856_100000031
136 Ga0068856_100004862
137 Ga0068852_100316097
138 Ga0105240_10180748
139 Ga0105243_10000007
140 Ga0105241_10233068
141 Ga0157375_10030086
142 Ga0182008_10031817
143 Ga0182007_10010975
144 Ga0182007_10052336
145 Ga0209130_1011305
146 Ga0207426_1000139
147 Ga0207684_10210990
148 Ga0207654_10153081
149 Ga0207695_10003033
150 Ga0207646_10168687
151 Ga0207644_10018977
152 Ga0207706_10074650
153 Ga0207709_10000049
154 Ga0207691_10016901
155 Ga0207667_10000154
156 Ga0207667_10025788
157 Ga0207702_10000071
158 Ga0265334_10020755
159 Ga0265334_10027109
160 Ga0265323_10000124
161 Ga0265323_10005254
162 Ga0265336_10005091
163 Ga0265338_10003408
164 Ga0265338_10004513
165 Ga0265338_10066825
166 Ga0265316_10000886
167 Ga0265316_10001403
168 Ga0265316_10001496
169 Ga0265316_10002071
170 Ga0307513_10050553
171 Ga0316576_10100650
172 Ga0395899_0000002
173 Ga0395899_0010050
174 Ga0395899_0079517
175 Ga0395900_0012055
176 Ga0395898_0006559
177 Ga0395898_0072823
178 Ga0395905_0000380
179 Ga0395905_0002066
180 Ga0395901_0000271
181 Ga0400490_19468
182 Ga0451577_0000015
183 Ga0451577_0000034
184 Ga0451577_0005644
185 Ga0451577_0019396
186 Ga0451577_0026246
187 Ga0451577_0062328
188 Ga0451577_0070748
189 Ga0451577_0189195
190 Ga0451577_0348640
191 Ga0453683_0000015
192 Ga0453683_0001190
193 Ga0453683_0072582
194 Ga0453683_0120016
195 Ga0453683_0133463
196 Ga0453683_0134235
197 Ga0453684_0000081
198 Ga0453684_0000086
199 Ga0453684_0000098
200 Ga0453684_0000438
201 Ga0453684_0000651
202 Ga0453684_0001862
203 Ga0453684_0003480
204 Ga0453684_0006366
205 Ga0453684_0012909
206 Ga0453684_0033763
207 Ga0453684_0037001
208 Ga0453684_0091899
209 Ga0451576_0000036
210 Ga0451576_0000080
211 Ga0451576_0000718
212 Ga0451576_0001696
213 Ga0451576_0009331
214 Ga0451576_0047568
215 Ga0451576_0088669
216 Ga0451576_0092668
217 Ga0495687_000385
218 Ga0495687_003888
219 Ga0496116_0037130
220 Ga0496117_0015551
221 Ga0496118_0069723
222 Ga0496123_0017733
223 Ga0496124_0093857
224 Ga0496125_0102800
225 nmdc:mga05p37_46207_c1
226 2722729862
227 2739301602
228 2819679083
229 2852627604
230 2904780812
231 2919180725
232 2929181819
233 2945984216
234 2946016390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06202

GDE_C

Amylo-alpha-1,6-glucosidase

280

384

0.77

PF12899

Glyco_hydro_100

Alkaline and neutral invertase

185

391

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hmm-assembly1.cif.gz_A crystal structure of aorhaa 0.7559 29 368
6ttj-assembly1.cif.gz_C neutral invertase 2 from arabidopsis thaliana 0.7546 11 387
6ttj-assembly1.cif.gz_L neutral invertase 2 from arabidopsis thaliana 0.754 11 387
6ttj-assembly2.cif.gz_J neutral invertase 2 from arabidopsis thaliana 0.7537 11 387
6ttj-assembly2.cif.gz_H neutral invertase 2 from arabidopsis thaliana 0.7422 11 387
ID Description Score Start End Superfamily
af_F4I2X9_96_502_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7389 37 368 1.50.10.10
af_Q10MC0_124_589_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7197 1 375 1.50.10.10
af_Q84JL5_269_595_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6994 95 377 1.50.10.10
af_Q10MC0_124_589_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6985 1 375 1.50.10.10
af_Q337G9_1_401_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6746 7 186 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A2M7JP20-F1-model_v4 beta-fructofuranosidase (EC 3.2.1.26) 0.9684 291 387 GO:0005975
GO:0033926
AF-A0A2M7JP20-F1-model_v4 beta-fructofuranosidase (EC 3.2.1.26) 0.9587 291 387 GO:0005975
GO:0033926
AF-A0A3N5SGN8-F1-model_v4 Amylo-alpha-1,6-glucosidase 0.9559 7 108 GO:0005975
AF-K1YGL4-F1-model_v4 beta-fructofuranosidase (EC 3.2.1.26) 0.9539 246 385 GO:0005975
GO:0016020
GO:0033926
AF-A0A3N5SGN8-F1-model_v4 Amylo-alpha-1,6-glucosidase 0.9294 7 108 GO:0005975

Map