F093656

General Info

Members Datasets Scaffolds Average Seq Length
117 92 109 364

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10007105|Ga0307510_100071055
Length 422
Sequence MIVLFFKRGISPISIHLLLLASPNGTLSRSIARRVPTVRNNVQYCGTMTASSAQRVVMGDTSPLIRKIVHVDMDAFYASVEQRDNPELRGKPVVVAWKGKRSVVCAASYDARRFGVRSAMPAVTAERLCPEAIFIPPDFVRYKAASSAARGIFQRYTDLIEPLSLDEAYLDVTENKMQLPTATRVAKMIREQIREELNLTASAGVAPNKFLAKIASDWKKPNGLFVIQPHEVQSFLLPLPVGRIPGVGQVTENRMKAVGIATVGDLYALELSTLEGHFGSYGLRLYQLARGIDHNPVVPNRVSKSISAEDTFPEDVPLADTEDQIRRLAEKVWKSSHGNARAAKTVVLKLKTKEFHSLTRSLTLPAPPSSCDELTGIALGLRERIELGPKQLFRLVGVGLSNFQTVEDPVSPLFDAESVEDK

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
5 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
6 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
7 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
8 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
54 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
77 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
87 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
88 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
89 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
90 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
91 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
92 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 0
Isolates 6.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0
Rhizoplane 1.71
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 5.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10092559 3300005288 Bacteria 1873
2 Ga0065707_10082043 3300005295 Bacteria 23744
3 Ga0070658_10165100 3300005327 Bacteria 1859
4 Ga0070658_10292880 3300005327 Bacteria 1387
5 Ga0070670_100090589 3300005331 Bacteria 2628
6 Ga0070680_100077644 3300005336 Bacteria 2735
7 Ga0070713_100001631 3300005436 Bacteria 14400
8 Ga0070681_10177938 3300005458 Bacteria 2049
9 Ga0070706_100005280 3300005467 Bacteria 12317
10 Ga0070707_100061051 3300005468 Bacteria 3615
11 Ga0070707_100398320 3300005468 Bacteria 1337
12 Ga0070679_100002127 3300005530 Bacteria 17854
13 Ga0070684_100079852 3300005535 Bacteria 2893
14 Ga0068853_100003449 3300005539 Bacteria 12095
15 Ga0070665_100003115 3300005548 Bacteria 17865
16 Ga0068857_100023125 3300005577 Bacteria 5467
17 Ga0068856_100000764 3300005614 Bacteria 34928
18 Ga0081539_10004837 3300005985 Bacteria 14431
19 Ga0081539_10049114 3300005985 Bacteria 2396
20 Ga0070717_10019807 3300006028 Bacteria 5282
21 Ga0075431_100171679 3300006847 Bacteria 2227
22 Ga0105240_10000002 3300009093 Bacteria 1924170
23 Ga0105240_10005113 3300009093 Bacteria 19635
24 Ga0105240_10007293 3300009093 Bacteria 16097
25 Ga0105240_10021399 3300009093 Bacteria 8602
26 Ga0105240_10251814 3300009093 Bacteria 2042
27 Ga0105248_10000049 3300009177 Bacteria 153741
28 Ga0105248_10001642 3300009177 Bacteria 24867
29 Ga0105238_10003473 3300009551 Bacteria 15690
30 Ga0105249_10078941 3300009553 Bacteria 3055
31 Ga0105239_10006442 3300010375 Bacteria 13615
32 Ga0105239_10053267 3300010375 Bacteria 4438
33 Ga0157373_10005262 3300013100 Bacteria 9715
34 Ga0157370_10002625 3300013104 Bacteria 21610
35 Ga0157370_10063947 3300013104 Bacteria 3484
36 Ga0157374_10008961 3300013296 Bacteria 8576
37 Ga0157374_10046890 3300013296 Bacteria 4004
38 Ga0163162_10000349 3300013306 Bacteria 42017
39 Ga0157375_10260862 3300013308 Bacteria 1894
40 Ga0157379_10011485 3300014968 Bacteria 7731
41 Ga0157379_10113799 3300014968 Bacteria 2432
42 Ga0157379_10172715 3300014968 Bacteria 1951
43 Ga0183363_1004 3300015690 Bacteria 416766
44 Ga0163161_10057202 3300017792 Bacteria 2833
45 Ga0207684_10041871 3300025910 Bacteria 3882
46 Ga0207695_10000002 3300025913 Bacteria 2188391
47 Ga0207695_10000174 3300025913 Bacteria 189006
48 Ga0207695_10005958 3300025913 Bacteria 15951
49 Ga0207695_10181569 3300025913 Bacteria 2025
50 Ga0207693_10172791 3300025915 Bacteria 1701
51 Ga0207657_10224342 3300025919 Bacteria 1504
52 Ga0207652_10005965 3300025921 Bacteria 9856
53 Ga0207646_10052490 3300025922 Bacteria 3648
54 Ga0207711_10000033 3300025941 Bacteria 193513
55 Ga0207711_10001608 3300025941 Bacteria 20879
56 Ga0207676_10016564 3300026095 Bacteria 5337
57 Ga0207674_10031069 3300026116 Bacteria 5612
58 Ga0207428_10012729 3300027907 Bacteria 7378
59 Ga0268266_10000141 3300028379 Bacteria 138510
60 Ga0307515_10058547 3300028794 Bacteria 5547
61 Ga0307510_10007105 3300033180 Bacteria 13335
62 Ga0373926_0000131 3300035083 Bacteria 15644
63 Ga0373923_0045702 3300035111 Bacteria 1819
64 Ga0373946_0002543 3300035171 Bacteria 6447
65 Ga0373927_0006243 3300035695 Bacteria 8133
66 Ga0373947_0006526 3300035725 Bacteria 6765
67 Ga0373925_0000260 3300037068 Bacteria 55009
68 Ga0395900_0004245 3300037418 Bacteria 15205
69 Ga0395905_0001449 3300037471 Bacteria 28496
70 Ga0395901_0078400 3300038443 Bacteria 3449
71 Ga0466966_0006429 3300044684 Bacteria 7773
72 Ga0466961_0021674 3300044693 Bacteria 4134
73 Ga0453684_0068875 3300044712 Bacteria 4491
74 Ga0466957_0019105 3300044842 Bacteria 4030
75 Ga0466959_0002702 3300045049 Bacteria 11395
76 Ga0466959_0020435 3300045049 Bacteria 4879
77 Ga0466958_0017283 3300045836 Bacteria 4166
78 Ga0495607_0017297 3300046501 Bacteria 4632
79 Ga0495583_0069259 3300046506 Bacteria 1554
80 Ga0495610_0083832 3300046512 Bacteria 1458
81 Ga0495630_0002837 3300046517 Bacteria 12017
82 Ga0495666_0004179 3300046526 Bacteria 7282
83 Ga0495609_0079203 3300046538 Bacteria 1437
84 Ga0495625_0092059 3300046660 Bacteria 2095
85 Ga0495649_0037649 3300046694 Bacteria 2655
86 Ga0495672_0001881 3300047320 Bacteria 19986
87 Ga0495673_0050865 3300047469 Bacteria 1817
88 Ga0495686_0027357 3300047472 Bacteria 3725
89 Ga0495686_0067060 3300047472 Bacteria 2216
90 Ga0495686_0080668 3300047472 Bacteria 1988
91 Ga0496108_0011685 3300048911 Bacteria 7142
92 Ga0496114_0349892 3300048917 Bacteria 1307
93 Ga0496126_0000020 3300048929 Bacteria 490805
94 Ga0496126_0011922 3300048929 Bacteria 8939
95 Ga0496126_0017062 3300048929 Bacteria 7242
96 Ga0495682_0004086 3300049460 Bacteria 6342
97 Ga0501035_0006069 3300049822 Bacteria 11376
98 nmdc:mga06r32_307428_c1 3300050510 Bacteria 1571
99 nmdc:mga06r32_46509_c1 3300050510 Bacteria 4141
100 nmdc:mga06r32_64162_c1 3300050510 Bacteria 3541
101 nmdc:mga08y16_17432_c1 3300050511 Bacteria 7563
102 nmdc:mga0n895_554590_c1 3300050512 Bacteria 1155
103 nmdc:mga08x19_18418_c1 3300050514 Bacteria 4279
104 Ga0500651_0000004 3300053093 Bacteria 389879
105 Ga0500555_017977 3300053103 Bacteria 2037
106 Ga0500595_000007 3300053119 Bacteria 289461
107 Ga0500622_0000031 3300053156 Bacteria 207165
108 Ga0500622_0000039 3300053156 Bacteria 170859
109 Ga0466962_0033149 3300061719 Bacteria 2471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0033149 Ga0466962_0033149_1509_2435 299
2 3300046538 Ga0495609_0079203 Ga0495609_0079203_473_1393 300
3 3300050512 nmdc:mga0n895_554590_c1 nmdc:mga0n895_554590_c1_95_1138 324
4 3300046512 Ga0495610_0083832 Ga0495610_0083832_24_1010 325
5 3300053103 Ga0500555_017977 Ga0500555_017977_846_1958 336
6 3300025915 Ga0207693_10172791 Ga0207693_101727912 339
7 3300025919 Ga0207657_10224342 Ga0207657_102243421 339
8 3300006847 Ga0075431_100171679 Ga0075431_1001716793 340
9 3300048929 Ga0496126_0000020 Ga0496126_0000020_62120_63181 340
10 3300050510 nmdc:mga06r32_46509_c1 nmdc:mga06r32_46509_c1_822_1934 340
11 3300005327 Ga0070658_10165100 Ga0070658_101651002 341
12 3300046694 Ga0495649_0037649 Ga0495649_0037649_1539_2621 342
13 3300005468 Ga0070707_100398320 Ga0070707_1003983201 343
14 3300009093 Ga0105240_10251814 Ga0105240_102518142 343
15 3300025913 Ga0207695_10181569 Ga0207695_101815692 343
16 3300046517 Ga0495630_0002837 Ga0495630_0002837_21_1058 343
17 3300005985 Ga0081539_10004837 Ga0081539_100048372 344
18 3300047320 Ga0495672_0001881 Ga0495672_0001881_1524_2651 344
19 iso_pu_bacteria 2738543023 2739301441 345
20 iso_pu_bacteria 2919186247 2919186439 345
21 3300037471 Ga0395905_0001449 Ga0395905_0001449_12809_13861 347
22 3300044842 Ga0466957_0019105 Ga0466957_0019105_29_1099 347
23 3300053156 Ga0500622_0000031 Ga0500622_0000031_4274_5317 347
24 3300047472 Ga0495686_0067060 Ga0495686_0067060_48_1115 350
25 3300005577 Ga0068857_100023125 Ga0068857_1000231257 351
26 3300006028 Ga0070717_10019807 Ga0070717_100198074 351
27 3300026116 Ga0207674_10031069 Ga0207674_100310696 351
28 3300048929 Ga0496126_0011922 Ga0496126_0011922_6099_7157 351
29 3300009093 Ga0105240_10007293 Ga0105240_100072937 352
30 3300009093 Ga0105240_10021399 Ga0105240_100213993 352
31 3300009177 Ga0105248_10001642 Ga0105248_100016422 352
32 3300009551 Ga0105238_10003473 Ga0105238_100034733 352
33 3300010375 Ga0105239_10006442 Ga0105239_100064426 352
34 3300013296 Ga0157374_10046890 Ga0157374_100468902 352
35 3300025913 Ga0207695_10000174 Ga0207695_10000174146 352
36 3300025913 Ga0207695_10005958 Ga0207695_100059585 352
37 3300025941 Ga0207711_10001608 Ga0207711_1000160811 352
38 3300047469 Ga0495673_0050865 Ga0495673_0050865_570_1643 352
39 3300005327 Ga0070658_10292880 Ga0070658_102928802 353
40 3300005436 Ga0070713_100001631 Ga0070713_1000016312 353
41 3300005548 Ga0070665_100003115 Ga0070665_1000031159 353
42 3300028379 Ga0268266_10000141 Ga0268266_1000014118 353
43 3300048929 Ga0496126_0017062 Ga0496126_0017062_631_1701 353
44 iso_pu_bacteria 2524614729 2525558253 353
45 iso_pu_bacteria 2627854209 2630650241 353
46 iso_pu_bacteria 2852627209 2852628807 353
47 3300005468 Ga0070707_100061051 Ga0070707_1000610513 354
48 3300025922 Ga0207646_10052490 Ga0207646_100524904 354
49 3300038443 Ga0395901_0078400 Ga0395901_0078400_1384_2466 355
50 3300053156 Ga0500622_0000039 Ga0500622_0000039_165007_166074 355
51 3300044712 Ga0453684_0068875 Ga0453684_0068875_109_1203 356
52 3300049822 Ga0501035_0006069 Ga0501035_0006069_2432_3520 356
53 3300053119 Ga0500595_000007 Ga0500595_000007_97525_98655 356
54 iso_pu_bacteria 2830075706 2830076388 356
55 3300005530 Ga0070679_100002127 Ga0070679_10000212712 357
56 3300013308 Ga0157375_10260862 Ga0157375_102608622 357
57 3300025921 Ga0207652_10005965 Ga0207652_100059655 357
58 3300027907 Ga0207428_10012729 Ga0207428_100127292 357
59 3300050510 nmdc:mga06r32_307428_c1 nmdc:mga06r32_307428_c1_139_1239 357
60 3300050510 nmdc:mga06r32_64162_c1 nmdc:mga06r32_64162_c1_773_1873 357
61 3300050511 nmdc:mga08y16_17432_c1 nmdc:mga08y16_17432_c1_615_1715 357
62 3300005336 Ga0070680_100077644 Ga0070680_1000776442 358
63 3300005458 Ga0070681_10177938 Ga0070681_101779382 358
64 3300005535 Ga0070684_100079852 Ga0070684_1000798523 358
65 3300005985 Ga0081539_10049114 Ga0081539_100491142 358
66 3300009093 Ga0105240_10000002 Ga0105240_10000002944 358
67 3300009177 Ga0105248_10000049 Ga0105248_1000004927 358
68 3300009553 Ga0105249_10078941 Ga0105249_100789412 358
69 3300014968 Ga0157379_10113799 Ga0157379_101137992 358
70 3300025913 Ga0207695_10000002 Ga0207695_10000002948 358
71 3300025941 Ga0207711_10000033 Ga0207711_1000003364 358
72 3300026095 Ga0207676_10016564 Ga0207676_100165642 358
73 3300033180 Ga0307510_10007105 Ga0307510_100071055 358
74 3300037418 Ga0395900_0004245 Ga0395900_0004245_9745_10866 358
75 3300044684 Ga0466966_0006429 Ga0466966_0006429_5603_6706 358
76 3300044693 Ga0466961_0021674 Ga0466961_0021674_2233_3336 358
77 3300045049 Ga0466959_0002702 Ga0466959_0002702_1068_2171 358
78 3300045836 Ga0466958_0017283 Ga0466958_0017283_418_1521 358
79 3300046506 Ga0495583_0069259 Ga0495583_0069259_218_1375 358
80 3300046660 Ga0495625_0092059 Ga0495625_0092059_762_1919 358
81 3300047472 Ga0495686_0080668 Ga0495686_0080668_810_1892 358
82 3300049460 Ga0495682_0004086 Ga0495682_0004086_2913_4070 358
83 3300053093 Ga0500651_0000004 Ga0500651_0000004_300684_301811 358
84 3300009093 Ga0105240_10005113 Ga0105240_100051136 359
85 3300035083 Ga0373926_0000131 Ga0373926_0000131_11001_12086 359
86 3300035111 Ga0373923_0045702 Ga0373923_0045702_427_1512 359
87 3300035171 Ga0373946_0002543 Ga0373946_0002543_1001_2086 359
88 3300035695 Ga0373927_0006243 Ga0373927_0006243_3544_4629 359
89 3300035725 Ga0373947_0006526 Ga0373947_0006526_3514_4599 359
90 3300037068 Ga0373925_0000260 Ga0373925_0000260_4009_5094 359
91 3300046501 Ga0495607_0017297 Ga0495607_0017297_53_1138 359
92 3300046526 Ga0495666_0004179 Ga0495666_0004179_2445_3530 359
93 3300047472 Ga0495686_0027357 Ga0495686_0027357_1597_2712 359
94 3300048911 Ga0496108_0011685 Ga0496108_0011685_4283_5407 359
95 3300050514 nmdc:mga08x19_18418_c1 nmdc:mga08x19_18418_c1_1812_2897 359
96 iso_pu_bacteria 2902048731 2902050956 359
97 iso_pu_bacteria 2939664404 2939666291 359
98 3300005331 Ga0070670_100090589 Ga0070670_1000905892 360
99 3300005467 Ga0070706_100005280 Ga0070706_1000052804 360
100 3300014968 Ga0157379_10011485 Ga0157379_100114853 360
101 3300014968 Ga0157379_10172715 Ga0157379_101727153 360
102 3300015690 Ga0183363_1004 Ga0183363_1004113 360
103 3300017792 Ga0163161_10057202 Ga0163161_100572024 360
104 3300025910 Ga0207684_10041871 Ga0207684_100418711 360
105 3300045049 Ga0466959_0020435 Ga0466959_0020435_3656_4771 360
106 3300048917 Ga0496114_0349892 Ga0496114_0349892_160_1251 360
107 3300005539 Ga0068853_100003449 Ga0068853_1000034496 361
108 3300010375 Ga0105239_10053267 Ga0105239_100532673 361
109 3300005295 Ga0065707_10082043 Ga0065707_1008204323 363
110 3300005614 Ga0068856_100000764 Ga0068856_10000076413 363
111 3300013104 Ga0157370_10063947 Ga0157370_100639472 363
112 3300013306 Ga0163162_10000349 Ga0163162_100003491 363
113 3300013100 Ga0157373_10005262 Ga0157373_100052629 364
114 3300013296 Ga0157374_10008961 Ga0157374_1000896110 364
115 3300005288 Ga0065714_10092559 Ga0065714_100925592 365
116 3300013104 Ga0157370_10002625 Ga0157370_100026255 365
117 3300028794 Ga0307515_10058547 Ga0307515_100585472 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00817

IMS

impB/mucB/samB family

71

217

0.99

PF21999

IMS_HHH_1

DNA polymerase-iota, thumb domain

242

293

0.97

PF11799

IMS_C

impB/mucB/samB family C-terminal domain

303

412

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r8u-assembly2.cif.gz_B s-sad structure of dinb-dna complex 0.9504 10 348
4r8u-assembly2.cif.gz_B s-sad structure of dinb-dna complex 0.9451 10 348
4q45-assembly1.cif.gz_F dna polymerase- damaged dna complex 0.9438 9 348
6ig1-assembly1.cif.gz_F dna polymerase iv - dna ternary complex 10 0.9406 9 348
6juq-assembly1.cif.gz_F mutant poliv-dna incoming nucleotide complex 2 0.9399 9 348
ID Description Score Start End Superfamily
4q43A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9642 9 182 3.30.70.270
af_A0A0R0LFA9_330_427_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.9623 247 331 3.30.1490.100
af_P9WNT1_245_346_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.9617 247 347 3.30.1490.100
af_P34409_94_147_3.40.1170.60 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.9616 21 78 3.40.1170.60
af_O74944_370_477_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.9571 246 349 3.30.1490.100
ID Description Score Start End GO Terms
AF-A0A2V8YHY1-F1-model_v4 DNA polymerase IV 0.9816 8 140 GO:0003887
GO:0005829
GO:0009432
GO:0042276
AF-A0A7C1QAL4-F1-model_v4 deleted 0.9815 10 243
AF-A0A6G1V7V9-F1-model_v4 deleted 0.9815 8 197
AF-A0A7V5R2L8-F1-model_v4 DNA polymerase IV 0.9782 10 148 GO:0003887
GO:0005829
GO:0009432
GO:0042276
AF-A0A7R9A0P7-F1-model_v4 DNA polymerase kappa (EC 2.7.7.7) 0.9781 66 241 GO:0003677
GO:0003887
GO:0005829
GO:0006260
GO:0042276
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.84 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map