F096604

General Info

Members Datasets Scaffolds Average Seq Length
118 95 236 184

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100494496|Ga0068852_1004944962
Length 210
Sequence LGLIFHGYLPLVKSIIKSGKKRFITHMSKRFLITTAFLLLLSSSFKEPVSIYNISKGNISFSSDAPLELITASSSELKGLIETEKKTFAFSVKVRSFKGFNSGFQKEHFNENYLESDKYPDATFTGKIIEDIDFTKNSVLSVRAKGILTVHGVPKERIIKSDMTIKNGAIFIKANFTVLLSDHNIPIPKVVHEKLASEIKVEVNSELKVR

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
41 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
67 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
70 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
71 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
72 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
73 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
82 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
90 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
91 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
92 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
93 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
94 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
95 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.63
Nodule 0
Rhizoplane 1.69
Rhizosphere 74.58
Stem 0
Stem Tuber 0
Unclassified 15.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100494496 3300005616 Unclassified 1217
2 rootH1_10004122 3300003316 Bacteria 2079
3 rootH2_10046329 3300003320 Bacteria 7957
4 rootL2_10197929 3300003322 Unclassified 2781
5 rootH1_10006023 3300003323 Bacteria 26459
6 rootH1_10343031 3300003323 Bacteria 3242
7 JGI25160J50197_1050823 3300003354 Bacteria 881
8 Ga0065704_10000799 3300005289 Bacteria 21658
9 Ga0065715_10176840 3300005293 Bacteria 1505
10 Ga0065715_10445553 3300005293 Bacteria 778
11 Ga0070683_100016844 3300005329 Bacteria 6447
12 Ga0070683_100188286 3300005329 Bacteria 1959
13 Ga0070683_100974567 3300005329 Unclassified 814
14 Ga0070690_100609800 3300005330 Bacteria 829
15 Ga0070670_100371804 3300005331 Bacteria 1258
16 Ga0070670_100435570 3300005331 Bacteria 1160
17 Ga0070682_100000041 3300005337 Bacteria 142152
18 Ga0070689_100235197 3300005340 Bacteria 1507
19 Ga0070667_100573809 3300005367 Bacteria 1038
20 Ga0070678_101195780 3300005456 Bacteria 705
21 Ga0070684_100035181 3300005535 Bacteria 4287
22 Ga0070684_100341479 3300005535 Unclassified 1377
23 Ga0070672_100716196 3300005543 Bacteria 877
24 Ga0070665_100385540 3300005548 Unclassified 1409
25 Ga0070664_100024770 3300005564 Bacteria 4968
26 Ga0070664_100136124 3300005564 Bacteria 2160
27 Ga0068854_100365826 3300005578 Bacteria 1184
28 Ga0068856_100322369 3300005614 Bacteria 1562
29 Ga0068856_101236747 3300005614 Bacteria 763
30 Ga0068851_10100626 3300005834 Bacteria 1533
31 Ga0068851_10363947 3300005834 Bacteria 844
32 Ga0097621_101013779 3300006237 Bacteria 777
33 Ga0068871_100669247 3300006358 Unclassified 949
34 Ga0068871_100727642 3300006358 Bacteria 911
35 Ga0075429_100999896 3300006880 Bacteria 731
36 Ga0105240_10033361 3300009093 Bacteria 6651
37 Ga0105240_10296548 3300009093 Bacteria 1851
38 Ga0114129_10012202 3300009147 Bacteria 12227
39 Ga0105243_10000002 3300009148 Bacteria 856281
40 Ga0157369_10053536 3300013105 Unclassified 4361
41 Ga0157374_10062911 3300013296 Bacteria 3479
42 Ga0157374_10115022 3300013296 Unclassified 2591
43 Ga0157374_10198570 3300013296 Bacteria 1964
44 Ga0157378_10172963 3300013297 Unclassified 2027
45 Ga0163162_11495650 3300013306 Bacteria 769
46 Ga0157372_10462871 3300013307 Bacteria 1478
47 Ga0157375_10003438 3300013308 Bacteria 13725
48 Ga0163163_10165073 3300014325 Bacteria 2260
49 Ga0157380_10000085 3300014326 Bacteria 52062
50 Ga0163161_10048268 3300017792 Bacteria 3075
51 Ga0213876_10004344 3300021384 Bacteria 7942
52 Ga0209436_101437 3300025208 Bacteria 8344
53 Ga0209646_1002923 3300025246 Bacteria 3560
54 Ga0209130_1002372 3300025284 Bacteria 9549
55 Ga0207426_1000233 3300025302 Bacteria 127848
56 Ga0207656_10070847 3300025321 Bacteria 1549
57 Ga0207695_10017901 3300025913 Bacteria 8209
58 Ga0207681_10392308 3300025923 Unclassified 1120
59 Ga0207650_10331437 3300025925 Bacteria 1248
60 Ga0207709_10000003 3300025935 Bacteria 1050072
61 Ga0207670_10233355 3300025936 Bacteria 1414
62 Ga0207661_10145918 3300025944 Bacteria 2041
63 Ga0207661_10298776 3300025944 Unclassified 1443
64 Ga0207661_10873971 3300025944 Unclassified 828
65 Ga0207679_10023771 3300025945 Bacteria 4195
66 Ga0207679_10469389 3300025945 Unclassified 1119
67 Ga0207640_10345330 3300025981 Bacteria 1194
68 Ga0207658_10295415 3300025986 Bacteria 1394
69 Ga0207639_10558330 3300026041 Bacteria 1052
70 Ga0207678_10213320 3300026067 Bacteria 1652
71 Ga0207702_11321751 3300026078 Bacteria 715
72 Ga0207676_10825208 3300026095 Unclassified 906
73 Ga0207698_10542584 3300026142 Bacteria 1138
74 Ga0207698_10662950 3300026142 Bacteria 1035
75 Ga0265327_10006390 3300031251 Bacteria 9439
76 Ga0307513_10100849 3300031456 Bacteria 2911
77 Ga0307412_11086038 3300031911 Bacteria 711
78 Ga0307414_10104978 3300032004 Bacteria 2135
79 Ga0307414_10179369 3300032004 Bacteria 1702
80 Ga0373940_0177481 3300035088 Unclassified 691
81 Ga0395900_0283739 3300037418 Bacteria 1647
82 Ga0395898_0118365 3300037466 Bacteria 2538
83 Ga0395901_0372733 3300038443 Unclassified 1470
84 Ga0400483_187442 3300039062 Bacteria 39307
85 Ga0400489_86568 3300039093 Bacteria 2320
86 Ga0436365_1658341 3300039437 Bacteria 10553
87 Ga0439436_0021063 3300041404 Bacteria 1940
88 Ga0451800_0068308 3300041459 Unclassified 863
89 Ga0451807_0307959 3300041486 Bacteria 828
90 Ga0451835_1037627 3300041492 Bacteria 1670
91 Ga0439457_001235 3300042014 Bacteria 7680
92 Ga0451577_0000418 3300042876 Bacteria 77022
93 Ga0451577_0222846 3300042876 Bacteria 1705
94 Ga0466972_0000318 3300044658 Bacteria 27740
95 Ga0466972_0025520 3300044658 Bacteria 2929
96 Ga0453683_0000402 3300044673 Bacteria 50984
97 Ga0453683_0518104 3300044673 Bacteria 774
98 Ga0453683_0947349 3300044673 Bacteria 570
99 Ga0453684_0001643 3300044712 Bacteria 60720
100 Ga0453684_1021803 3300044712 Bacteria 878
101 Ga0466959_1015507 3300045049 Bacteria 552
102 Ga0495625_0642089 3300046660 Bacteria 633
103 Ga0495672_0022174 3300047320 Bacteria 4133
104 Ga0496116_0015026 3300048919 Bacteria 6140
105 Ga0496117_0030909 3300048920 Bacteria 4099
106 Ga0496122_0013429 3300048925 Bacteria 8016
107 Ga0496123_0045281 3300048926 Bacteria 2999
108 Ga0496124_0144925 3300048927 Bacteria 1870
109 Ga0496126_0778595 3300048929 Bacteria 736
110 Ga0501225_0000213 3300049705 Bacteria 18280
111 nmdc:mga05p37_11886_c1 3300050507 Bacteria 10380
112 Ga0500646_0098950 3300053090 Bacteria 913
113 Ga0500583_0017229 3300053092 Bacteria 2905
114 Ga0500559_0282043 3300053136 Bacteria 781
115 Ga0500568_0256635 3300053139 Unclassified 636
116 Ga0500577_0211623 3300053142 Bacteria 838
117 2884797308 2884791551 Bacteria 8511252
118 2904782091 2904780799 Bacteria 5840761
119 Ga0068852_100494496
120 rootH1_10004122
121 rootH2_10046329
122 rootL2_10197929
123 rootH1_10006023
124 rootH1_10343031
125 JGI25160J50197_1050823
126 Ga0065704_10000799
127 Ga0065715_10176840
128 Ga0065715_10445553
129 Ga0070683_100016844
130 Ga0070683_100188286
131 Ga0070683_100974567
132 Ga0070690_100609800
133 Ga0070670_100371804
134 Ga0070670_100435570
135 Ga0070682_100000041
136 Ga0070689_100235197
137 Ga0070667_100573809
138 Ga0070678_101195780
139 Ga0070684_100035181
140 Ga0070684_100341479
141 Ga0070672_100716196
142 Ga0070665_100385540
143 Ga0070664_100024770
144 Ga0070664_100136124
145 Ga0068854_100365826
146 Ga0068856_100322369
147 Ga0068856_101236747
148 Ga0068851_10100626
149 Ga0068851_10363947
150 Ga0097621_101013779
151 Ga0068871_100669247
152 Ga0068871_100727642
153 Ga0075429_100999896
154 Ga0105240_10033361
155 Ga0105240_10296548
156 Ga0114129_10012202
157 Ga0105243_10000002
158 Ga0157369_10053536
159 Ga0157374_10062911
160 Ga0157374_10115022
161 Ga0157374_10198570
162 Ga0157378_10172963
163 Ga0163162_11495650
164 Ga0157372_10462871
165 Ga0157375_10003438
166 Ga0163163_10165073
167 Ga0157380_10000085
168 Ga0163161_10048268
169 Ga0213876_10004344
170 Ga0209436_101437
171 Ga0209646_1002923
172 Ga0209130_1002372
173 Ga0207426_1000233
174 Ga0207656_10070847
175 Ga0207695_10017901
176 Ga0207681_10392308
177 Ga0207650_10331437
178 Ga0207709_10000003
179 Ga0207670_10233355
180 Ga0207661_10145918
181 Ga0207661_10298776
182 Ga0207661_10873971
183 Ga0207679_10023771
184 Ga0207679_10469389
185 Ga0207640_10345330
186 Ga0207658_10295415
187 Ga0207639_10558330
188 Ga0207678_10213320
189 Ga0207702_11321751
190 Ga0207676_10825208
191 Ga0207698_10542584
192 Ga0207698_10662950
193 Ga0265327_10006390
194 Ga0307513_10100849
195 Ga0307412_11086038
196 Ga0307414_10104978
197 Ga0307414_10179369
198 Ga0373940_0177481
199 Ga0395900_0283739
200 Ga0395898_0118365
201 Ga0395901_0372733
202 Ga0400483_187442
203 Ga0400489_86568
204 Ga0436365_1658341
205 Ga0439436_0021063
206 Ga0451800_0068308
207 Ga0451807_0307959
208 Ga0451835_1037627
209 Ga0439457_001235
210 Ga0451577_0000418
211 Ga0451577_0222846
212 Ga0466972_0000318
213 Ga0466972_0025520
214 Ga0453683_0000402
215 Ga0453683_0518104
216 Ga0453683_0947349
217 Ga0453684_0001643
218 Ga0453684_1021803
219 Ga0466959_1015507
220 Ga0495625_0642089
221 Ga0495672_0022174
222 Ga0496116_0015026
223 Ga0496117_0030909
224 Ga0496122_0013429
225 Ga0496123_0045281
226 Ga0496124_0144925
227 Ga0496126_0778595
228 Ga0501225_0000213
229 nmdc:mga05p37_11886_c1
230 Ga0500646_0098950
231 Ga0500583_0017229
232 Ga0500559_0282043
233 Ga0500568_0256635
234 Ga0500577_0211623
235 2884797308
236 2904782091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

52

207

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q34-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8665 22 181
2x34-assembly2.cif.gz_B structure of a polyisoprenoid binding domain from saccharophagus degradans implicated in plant cell wall breakdown 0.8519 19 182
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8208 28 178
3q34-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8187 21 183
2x32-assembly1.cif.gz_A structure of a polyisoprenoid binding domain from saccharophagus degradans implicated in plant cell wall breakdown 0.8139 20 182
ID Description Score Start End Superfamily
2x34B00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8305 19 182 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8017 21 183 2.40.128.110
2x34B00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7952 19 182 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7911 43 183 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7897 21 179 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A7C7BNI7-F1-model_v4 YceI family protein 0.9843 56 183
AF-A0A7C4NYX5-F1-model_v4 YceI family protein 0.9823 13 183
AF-A0A1V5NK49-F1-model_v4 YceI-like domain protein 0.9821 13 183
AF-A0A350BT58-F1-model_v4 YceI family protein 0.9811 50 183
AF-G8TAY6-F1-model_v4 YceI family protein 0.9796 1 183

Map