F097307

General Info

Members Datasets Scaffolds Average Seq Length
118 93 238 164

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10135948|Ga0157371_101359484
Length 181
Sequence LFYFSIVARPTFERKNTMTMLNLFLLSTAVVSGLIAGLFYSYSCSVNPGLGALSDSNYLSAMQSINRAILNPVFFCSFMGTLLLLPISTYQHYGTGNRFYLLLAATLVYAVGTFGVTMFGNVPLNEALAKIDLTNASAQELAEYRSRFEIPWNRLNAIRTYASILAFVLTLIACLTTLEKH

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
43 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
68 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
74 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
77 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
81 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
82 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
83 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
84 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
85 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
86 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
87 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
88 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
89 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
90 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
91 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
92 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
93 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 0
Isolates 7.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 0
Rhizoplane 1.69
Rhizosphere 61.02
Stem 0
Stem Tuber 0
Unclassified 12.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10135948 3300013102 Bacteria 1750
2 SwRhRL2b_contig_957174 2162886007 Bacteria 2841
3 JGI24740J21852_10000578 3300001979 Bacteria 15758
4 JGI25162J39368_1000062 3300002737 Bacteria 135587
5 JGI25157J39369_1007607 3300002741 Bacteria 1555
6 JGI25153J46596_10002795 3300003215 Bacteria 9923
7 rootH1_10000974 3300003316 Bacteria 16614
8 rootH1_10054042 3300003316 Unclassified 1274
9 rootH1_10139439 3300003316 Unclassified 1442
10 rootH1_10176589 3300003316 Bacteria 4391
11 rootH2_10002048 3300003320 Bacteria 70313
12 rootH2_10004965 3300003320 Bacteria 3797
13 rootL2_10014336 3300003322 Bacteria 5059
14 rootL2_10057280 3300003322 Bacteria 1388
15 rootH1_10004301 3300003316 Bacteria 2946
16 rootH1_10004301 3300003323 Bacteria 21275
17 rootH1_10066479 3300003323 Unclassified 1098
18 rootH1_10147241 3300003316 Bacteria 2066
19 rootH1_10147241 3300003323 Bacteria 1721
20 rootH1_10170398 3300003323 Bacteria 8549
21 JGI25160J50197_1005562 3300003354 Bacteria 5226
22 Ga0055531_10000056 3300003794 Bacteria 123579
23 Ga0065165_1000085 3300005262 Bacteria 154355
24 Ga0065714_10011685 3300005288 Bacteria 2644
25 Ga0065714_10088822 3300005288 Bacteria 2002
26 Ga0065704_10071351 3300005289 Bacteria 11575
27 Ga0065704_10075382 3300005289 Bacteria 5621
28 Ga0070658_10518983 3300005327 Unclassified 1030
29 Ga0070668_100002132 3300005347 Bacteria 14468
30 Ga0070667_101432181 3300005367 Bacteria 648
31 Ga0070714_100205314 3300005435 Bacteria 1804
32 Ga0070685_10306795 3300005466 Bacteria 1071
33 Ga0068853_100184277 3300005539 Bacteria 1894
34 Ga0070665_100232597 3300005548 Bacteria 1843
35 Ga0068855_100069101 3300005563 Bacteria 4111
36 Ga0068854_100034992 3300005578 Bacteria 3514
37 Ga0068854_100461468 3300005578 Bacteria 1063
38 Ga0068856_100628887 3300005614 Bacteria 1094
39 Ga0068859_101519620 3300005617 Bacteria 739
40 Ga0068861_100224344 3300005719 Bacteria 1590
41 Ga0068860_101341572 3300005843 Bacteria 736
42 Ga0097620_101519273 3300006931 Bacteria 739
43 Ga0105240_10190717 3300009093 Bacteria 2410
44 Ga0105240_10282201 3300009093 Bacteria 1907
45 Ga0105240_10712368 3300009093 Bacteria 1094
46 Ga0105243_10006077 3300009148 Bacteria 9334
47 Ga0105241_10091383 3300009174 Bacteria 2401
48 Ga0105242_11006060 3300009176 Unclassified 842
49 Ga0105237_10040816 3300009545 Bacteria 4680
50 Ga0105237_10139802 3300009545 Bacteria 2416
51 Ga0105239_10002817 3300010375 Bacteria 21748
52 Ga0105239_10003325 3300010375 Bacteria 19787
53 Ga0105239_10014883 3300010375 Bacteria 8624
54 Ga0105239_10234719 3300010375 Bacteria 2058
55 Ga0105239_10964173 3300010375 Bacteria 980
56 Ga0157370_10886995 3300013104 Bacteria 810
57 Ga0157380_10010278 3300014326 Bacteria 6728
58 Ga0182006_1025327 3300015261 Bacteria 2438
59 Ga0163161_10017380 3300017792 Bacteria 5033
60 Ga0209437_100177 3300025233 Bacteria 135759
61 Ga0207425_1029444 3300025245 Unclassified 1107
62 Ga0209646_1000009 3300025246 Bacteria 652154
63 Ga0209026_1000188 3300025250 Bacteria 90347
64 Ga0209148_1028508 3300025254 Bacteria 849
65 Ga0209455_1004135 3300025272 Bacteria 4866
66 Ga0209676_1000695 3300025292 Bacteria 47271
67 Ga0209758_1004751 3300025297 Bacteria 11024
68 Ga0207426_1000793 3300025302 Bacteria 34331
69 Ga0207426_1081256 3300025302 Unclassified 879
70 Ga0209257_1000077 3300025304 Bacteria 317964
71 Ga0207705_10423484 3300025909 Unclassified 1031
72 Ga0207695_10143575 3300025913 Bacteria 2333
73 Ga0207671_10003748 3300025914 Bacteria 14974
74 Ga0207671_10005474 3300025914 Bacteria 11687
75 Ga0207650_10032674 3300025925 Bacteria 3765
76 Ga0207664_11520412 3300025929 Bacteria 591
77 Ga0207709_10003328 3300025935 Bacteria 9628
78 Ga0207667_10300944 3300025949 Bacteria 1639
79 Ga0207640_10174908 3300025981 Bacteria 1604
80 Ga0207702_10624383 3300026078 Bacteria 1059
81 Ga0307513_10078067 3300031456 Bacteria 3426
82 Ga0307513_10284792 3300031456 Bacteria 1428
83 Ga0307405_10000001 3300031731 Bacteria 1731270
84 Ga0307406_10024396 3300031901 Bacteria 3612
85 Ga0307412_10058415 3300031911 Unclassified 2580
86 Ga0307414_10001250 3300032004 Bacteria 13112
87 Ga0307414_10051950 3300032004 Bacteria 2849
88 Ga0307414_10067635 3300032004 Unclassified 2560
89 Ga0436364_0212144 3300037853 Unclassified 546
90 Ga0439436_0098405 3300041404 Unclassified 815
91 Ga0439431_0069789 3300041997 Bacteria 935
92 Ga0439449_0126579 3300042007 Bacteria 949
93 Ga0450890_020878 3300042127 Unclassified 889
94 Ga0466964_0312883 3300044706 Unclassified 795
95 Ga0466968_0038848 3300044735 Bacteria 2001
96 Ga0495625_0021833 3300046660 Bacteria 4917
97 Ga0495672_0048489 3300047320 Bacteria 2518
98 Ga0495686_0000693 3300047472 Bacteria 45522
99 Ga0495686_0168398 3300047472 Bacteria 1276
100 Ga0496101_0281033 3300048904 Bacteria 1301
101 Ga0496115_0281423 3300048918 Bacteria 1365
102 Ga0496122_0000412 3300048925 Bacteria 90921
103 Ga0496122_0000950 3300048925 Bacteria 52444
104 Ga0496123_0014158 3300048926 Bacteria 6631
105 Ga0496126_0009490 3300048929 Bacteria 10323
106 Ga0501047_0154207 3300049581 Bacteria 2171
107 Ga0501241_001387 3300049758 Bacteria 4975
108 Ga0500641_0111985 3300053096 Bacteria 1175
109 Ga0500564_187950 3300053138 Bacteria 857
110 Ga0500568_0018956 3300053139 Unclassified 3002
111 Ga0500622_0000216 3300053156 Bacteria 61250
112 2522553242 2522125168 Bacteria 7376607
113 2587678453 2585428045 Bacteria 5203023
114 2590600511 2588254255 Bacteria 5014294
115 2884797903 2884791551 Bacteria 8511252
116 2919440992 2919437846 Bacteria 6199444
117 2929924227 2929921140 Bacteria 8649150
118 8003156088 8003151029 Bacteria 8187759
119 8003320031 8003314358 Bacteria 10575343
120 8055591652 8055588893 Bacteria 3619545
121 Ga0157371_10135948
122 SwRhRL2b_contig_957174
123 JGI24740J21852_10000578
124 JGI25162J39368_1000062
125 JGI25157J39369_1007607
126 JGI25153J46596_10002795
127 rootH1_10000974
128 rootH1_10054042
129 rootH1_10139439
130 rootH1_10176589
131 rootH2_10002048
132 rootH2_10004965
133 rootL2_10014336
134 rootL2_10057280
135 rootH1_10004301
136 rootH1_10066479
137 rootH1_10147241
138 rootH1_10170398
139 JGI25160J50197_1005562
140 Ga0055531_10000056
141 Ga0065165_1000085
142 Ga0065714_10011685
143 Ga0065714_10088822
144 Ga0065704_10071351
145 Ga0065704_10075382
146 Ga0070658_10518983
147 Ga0070668_100002132
148 Ga0070667_101432181
149 Ga0070714_100205314
150 Ga0070685_10306795
151 Ga0068853_100184277
152 Ga0070665_100232597
153 Ga0068855_100069101
154 Ga0068854_100034992
155 Ga0068854_100461468
156 Ga0068856_100628887
157 Ga0068859_101519620
158 Ga0068861_100224344
159 Ga0068860_101341572
160 Ga0097620_101519273
161 Ga0105240_10190717
162 Ga0105240_10282201
163 Ga0105240_10712368
164 Ga0105243_10006077
165 Ga0105241_10091383
166 Ga0105242_11006060
167 Ga0105237_10040816
168 Ga0105237_10139802
169 Ga0105239_10002817
170 Ga0105239_10003325
171 Ga0105239_10014883
172 Ga0105239_10234719
173 Ga0105239_10964173
174 Ga0157370_10886995
175 Ga0157380_10010278
176 Ga0182006_1025327
177 Ga0163161_10017380
178 Ga0209437_100177
179 Ga0207425_1029444
180 Ga0209646_1000009
181 Ga0209026_1000188
182 Ga0209148_1028508
183 Ga0209455_1004135
184 Ga0209676_1000695
185 Ga0209758_1004751
186 Ga0207426_1000793
187 Ga0207426_1081256
188 Ga0209257_1000077
189 Ga0207705_10423484
190 Ga0207695_10143575
191 Ga0207671_10003748
192 Ga0207671_10005474
193 Ga0207650_10032674
194 Ga0207664_11520412
195 Ga0207709_10003328
196 Ga0207667_10300944
197 Ga0207640_10174908
198 Ga0207702_10624383
199 Ga0307513_10078067
200 Ga0307513_10284792
201 Ga0307405_10000001
202 Ga0307406_10024396
203 Ga0307412_10058415
204 Ga0307414_10001250
205 Ga0307414_10051950
206 Ga0307414_10067635
207 Ga0436364_0212144
208 Ga0439436_0098405
209 Ga0439431_0069789
210 Ga0439449_0126579
211 Ga0450890_020878
212 Ga0466964_0312883
213 Ga0466968_0038848
214 Ga0495625_0021833
215 Ga0495672_0048489
216 Ga0495686_0000693
217 Ga0495686_0168398
218 Ga0496101_0281033
219 Ga0496115_0281423
220 Ga0496122_0000412
221 Ga0496122_0000950
222 Ga0496123_0014158
223 Ga0496126_0009490
224 Ga0501047_0154207
225 Ga0501241_001387
226 Ga0500641_0111985
227 Ga0500564_187950
228 Ga0500568_0018956
229 Ga0500622_0000216
230 2522553242
231 2587678453
232 2590600511
233 2884797903
234 2919440992
235 2929924227
236 8003156088
237 8003320031
238 8055591652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08592

Anthrone_oxy

Anthrone oxygenase

59

169

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z62-assembly1.cif.gz_C structure of human cytochrome c oxidase 0.5884 12 159
7y5e-assembly1.cif.gz_QL in situ single-pbs-psii-psi-lhcs megacomplex. 0.5812 11 158
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.5598 10 154
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.5477 14 158
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.5352 10 154
ID Description Score Start End Superfamily
af_Q9C0W5_1_160_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7943 7 161 1.20.120.550
af_Q9C0W5_1_160_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7599 7 161 1.20.120.550
af_Q9Y876_1_215_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6552 7 159 1.20.1250.20
af_Q02774_1_210_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6479 3 161 1.20.1250.20
af_I1N1W5_186_378_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6048 2 167 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A4Z0QD98-F1-model_v4 DUF1772 domain-containing protein 0.993 5 161 GO:0016020
AF-A0A4R3AD32-F1-model_v4 Putative membrane protein 0.992 7 163 GO:0016020
AF-A0A1G9K5T5-F1-model_v4 Uncharacterized membrane protein 0.9916 6 164 GO:0016020
AF-A0A841F7B0-F1-model_v4 Putative membrane protein 0.9915 7 164 GO:0016020
AF-A0A7X5YTQ0-F1-model_v4 deleted 0.9914 5 163

Map