F097784

General Info

Members Datasets Scaffolds Average Seq Length
118 63 236 180

Family's Representative Sequence

Representative Sequence 3300028666|Ga0265336_10000018|Ga0265336_1000001845
Length 205
Sequence MATTFTKEKSASTFASLKGKFGWTNPMQAPRLMKIVVSAGVGSQKDKKKLELIADRLGKITGQKAAPRGAKQAISNFKTRQGDVVGYQVTLRGARMNNFLDRLVNIALPRTRDFRGLSPKGIDSMGNYTLGIREHMIFPETADEDIKDVFGLAITLVTTSHSKAEVQAFLEHLGMPLKKTDTGPDLELAASHASREKKPAKKAKK

Samples

Sample ID Description Type Environment
1 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
14 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
23 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
24 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
25 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
26 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
27 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
28 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
29 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
30 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
31 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
32 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
41 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
42 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
45 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
46 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
47 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
48 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
54 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
55 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
56 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
57 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
58 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
59 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
61 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
62 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
63 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 0
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 20.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265336_10000018 3300028666 Bacteria 221454
2 Ga0070680_100046033 3300005336 Unclassified 3548
3 Ga0070680_100189095 3300005336 Bacteria 1735
4 Ga0070680_100229033 3300005336 Unclassified 1569
5 Ga0070680_100367834 3300005336 Bacteria 1223
6 Ga0070671_100000525 3300005355 Bacteria 26873
7 Ga0070701_10001741 3300005438 Bacteria 8190
8 Ga0070711_100000148 3300005439 Bacteria 37852
9 Ga0070711_100019344 3300005439 Unclassified 4368
10 Ga0070700_100064887 3300005441 Unclassified 2313
11 Ga0070681_10003074 3300005458 Bacteria 15488
12 Ga0070679_100006532 3300005530 Bacteria 10868
13 Ga0070679_100072827 3300005530 Bacteria 3428
14 Ga0070679_100118635 3300005530 Unclassified 2631
15 Ga0070679_100204126 3300005530 Unclassified 1941
16 Ga0070679_100752386 3300005530 Bacteria 917
17 Ga0070686_100279588 3300005544 Bacteria 1230
18 Ga0070686_100388366 3300005544 Bacteria 1058
19 Ga0070704_100000002 3300005549 Bacteria 162543
20 Ga0070704_100475351 3300005549 Bacteria 1080
21 Ga0068855_100047704 3300005563 Bacteria 5060
22 Ga0068855_100152716 3300005563 Bacteria 2625
23 Ga0068855_100318022 3300005563 Unclassified 1721
24 Ga0068855_101389988 3300005563 Unclassified 724
25 Ga0068860_100000012 3300005843 Bacteria 326398
26 Ga0105247_10489046 3300009101 Bacteria 894
27 Ga0207707_10000021 3300025912 Bacteria 199548
28 Ga0207663_10000002 3300025916 Bacteria 534155
29 Ga0207660_10089820 3300025917 Unclassified 2275
30 Ga0207660_10178460 3300025917 Bacteria 1648
31 Ga0207660_10197063 3300025917 Unclassified 1571
32 Ga0207660_10300273 3300025917 Bacteria 1278
33 Ga0207652_10031978 3300025921 Unclassified 4420
34 Ga0207652_10107848 3300025921 Unclassified 2467
35 Ga0207652_10187876 3300025921 Bacteria 1858
36 Ga0207652_10193200 3300025921 Unclassified 1831
37 Ga0207652_10205396 3300025921 Unclassified 1773
38 Ga0207644_10011555 3300025931 Bacteria 5845
39 Ga0207667_10047936 3300025949 Bacteria 4519
40 Ga0207667_10337261 3300025949 Bacteria 1539
41 Ga0207708_10195953 3300026075 Bacteria 1610
42 Ga0268264_10000286 3300028381 Bacteria 85090
43 Ga0265337_1077911 3300028556 Bacteria 908
44 Ga0265337_1112869 3300028556 Unclassified 738
45 Ga0265319_1084102 3300028563 Bacteria 1008
46 Ga0265318_10005814 3300028577 Bacteria 5751
47 Ga0265322_10020265 3300028654 Unclassified 1907
48 Ga0265336_10008705 3300028666 Bacteria 3542
49 Ga0265338_10000002 3300028800 Bacteria 856588
50 Ga0265338_10001848 3300028800 Bacteria 33242
51 Ga0265338_10002946 3300028800 Bacteria 24699
52 Ga0265338_10004670 3300028800 Bacteria 18384
53 Ga0265338_10047320 3300028800 Bacteria 3929
54 Ga0265338_10053795 3300028800 Bacteria 3597
55 Ga0265338_10220530 3300028800 Bacteria 1417
56 Ga0265338_10265503 3300028800 Bacteria 1260
57 Ga0265338_10276190 3300028800 Bacteria 1229
58 Ga0265338_10386523 3300028800 Bacteria 1000
59 Ga0265324_10006713 3300029957 Bacteria 4755
60 Ga0265324_10040391 3300029957 Bacteria 1615
61 Ga0265330_10113051 3300031235 Bacteria 1159
62 Ga0265328_10235463 3300031239 Bacteria 699
63 Ga0265340_10000007 3300031247 Bacteria 126609
64 Ga0265327_10019282 3300031251 Unclassified 4198
65 Ga0265327_10057292 3300031251 Bacteria 2005
66 Ga0265316_10022257 3300031344 Bacteria 5349
67 Ga0265316_10305387 3300031344 Bacteria 1158
68 Ga0307408_100227623 3300031548 Unclassified 1525
69 Ga0265313_10010842 3300031595 Bacteria 5722
70 Ga0307416_101253795 3300032002 Bacteria 847
71 Ga0373930_0024513 3300034816 Bacteria 1206
72 Ga0395900_0354541 3300037418 Bacteria 1440
73 Ga0400490_01868 3300038726 Bacteria 1547
74 Ga0451577_0000039 3300042876 Bacteria 346861
75 Ga0451577_0310595 3300042876 Bacteria 1429
76 Ga0453684_0000112 3300044712 Bacteria 359823
77 Ga0453684_0012681 3300044712 Bacteria 13842
78 Ga0451576_0008260 3300045051 Bacteria 12241
79 Ga0451576_0013592 3300045051 Bacteria 9100
80 Ga0451576_1223141 3300045051 Unclassified 784
81 Ga0501031_0000265 3300049568 Bacteria 29555
82 Ga0501032_0001849 3300049569 Bacteria 16742
83 Ga0501034_0000060 3300049571 Bacteria 197090
84 Ga0501034_0001176 3300049571 Bacteria 36245
85 Ga0501034_0031177 3300049571 Bacteria 5418
86 Ga0501034_0045271 3300049571 Bacteria 4447
87 Ga0501034_0147221 3300049571 Bacteria 2332
88 Ga0501034_0573913 3300049571 Bacteria 1035
89 Ga0501034_0594405 3300049571 Unclassified 1013
90 Ga0501037_0000352 3300049573 Bacteria 38822
91 Ga0501037_0036974 3300049573 Bacteria 3598
92 Ga0501037_0050012 3300049573 Bacteria 3060
93 Ga0501037_0519368 3300049573 Bacteria 806
94 Ga0501038_0005272 3300049574 Bacteria 12025
95 Ga0501038_0617059 3300049574 Bacteria 819
96 Ga0501039_0000150 3300049575 Bacteria 47570
97 Ga0501039_0036121 3300049575 Bacteria 3812
98 Ga0501040_0000708 3300049576 Bacteria 20547
99 Ga0501041_0016202 3300049577 Bacteria 4430
100 Ga0501042_0029078 3300049578 Bacteria 3898
101 Ga0501043_0000073 3300049579 Bacteria 88500
102 Ga0501046_0009610 3300049580 Bacteria 8342
103 Ga0501047_0179478 3300049581 Unclassified 1984
104 Ga0501047_0184792 3300049581 Bacteria 1950
105 Ga0501047_0466353 3300049581 Bacteria 1091
106 Ga0501068_0454981 3300049584 Bacteria 828
107 Ga0501073_0010566 3300049589 Bacteria 6760
108 Ga0501074_0185289 3300049590 Bacteria 1484
109 Ga0501080_0078557 3300049742 Unclassified 3069
110 Ga0501080_0139707 3300049742 Bacteria 2240
111 Ga0501083_0011418 3300049744 Bacteria 6229
112 Ga0501035_0004161 3300049822 Bacteria 13751
113 Ga0501035_0136167 3300049822 Unclassified 2138
114 Ga0501045_0074861 3300049824 Bacteria 2493
115 Ga0500616_0000055 3300053153 Bacteria 289080
116 Ga0501084_0014528 3300054114 Bacteria 6528
117 Ga0501084_1618848 3300054114 Unclassified 541
118 Ga0501082_0000004 3300060353 Bacteria 149261
119 Ga0265336_10000018
120 Ga0070680_100046033
121 Ga0070680_100189095
122 Ga0070680_100229033
123 Ga0070680_100367834
124 Ga0070671_100000525
125 Ga0070701_10001741
126 Ga0070711_100000148
127 Ga0070711_100019344
128 Ga0070700_100064887
129 Ga0070681_10003074
130 Ga0070679_100006532
131 Ga0070679_100072827
132 Ga0070679_100118635
133 Ga0070679_100204126
134 Ga0070679_100752386
135 Ga0070686_100279588
136 Ga0070686_100388366
137 Ga0070704_100000002
138 Ga0070704_100475351
139 Ga0068855_100047704
140 Ga0068855_100152716
141 Ga0068855_100318022
142 Ga0068855_101389988
143 Ga0068860_100000012
144 Ga0105247_10489046
145 Ga0207707_10000021
146 Ga0207663_10000002
147 Ga0207660_10089820
148 Ga0207660_10178460
149 Ga0207660_10197063
150 Ga0207660_10300273
151 Ga0207652_10031978
152 Ga0207652_10107848
153 Ga0207652_10187876
154 Ga0207652_10193200
155 Ga0207652_10205396
156 Ga0207644_10011555
157 Ga0207667_10047936
158 Ga0207667_10337261
159 Ga0207708_10195953
160 Ga0268264_10000286
161 Ga0265337_1077911
162 Ga0265337_1112869
163 Ga0265319_1084102
164 Ga0265318_10005814
165 Ga0265322_10020265
166 Ga0265336_10008705
167 Ga0265338_10000002
168 Ga0265338_10001848
169 Ga0265338_10002946
170 Ga0265338_10004670
171 Ga0265338_10047320
172 Ga0265338_10053795
173 Ga0265338_10220530
174 Ga0265338_10265503
175 Ga0265338_10276190
176 Ga0265338_10386523
177 Ga0265324_10006713
178 Ga0265324_10040391
179 Ga0265330_10113051
180 Ga0265328_10235463
181 Ga0265340_10000007
182 Ga0265327_10019282
183 Ga0265327_10057292
184 Ga0265316_10022257
185 Ga0265316_10305387
186 Ga0307408_100227623
187 Ga0265313_10010842
188 Ga0307416_101253795
189 Ga0373930_0024513
190 Ga0395900_0354541
191 Ga0400490_01868
192 Ga0451577_0000039
193 Ga0451577_0310595
194 Ga0453684_0000112
195 Ga0453684_0012681
196 Ga0451576_0008260
197 Ga0451576_0013592
198 Ga0451576_1223141
199 Ga0501031_0000265
200 Ga0501032_0001849
201 Ga0501034_0000060
202 Ga0501034_0001176
203 Ga0501034_0031177
204 Ga0501034_0045271
205 Ga0501034_0147221
206 Ga0501034_0573913
207 Ga0501034_0594405
208 Ga0501037_0000352
209 Ga0501037_0036974
210 Ga0501037_0050012
211 Ga0501037_0519368
212 Ga0501038_0005272
213 Ga0501038_0617059
214 Ga0501039_0000150
215 Ga0501039_0036121
216 Ga0501040_0000708
217 Ga0501041_0016202
218 Ga0501042_0029078
219 Ga0501043_0000073
220 Ga0501046_0009610
221 Ga0501047_0179478
222 Ga0501047_0184792
223 Ga0501047_0466353
224 Ga0501068_0454981
225 Ga0501073_0010566
226 Ga0501074_0185289
227 Ga0501080_0078557
228 Ga0501080_0139707
229 Ga0501083_0011418
230 Ga0501035_0004161
231 Ga0501035_0136167
232 Ga0501045_0074861
233 Ga0500616_0000055
234 Ga0501084_0014528
235 Ga0501084_1618848
236 Ga0501082_0000004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

84

177

0.98

PF00281

Ribosomal_L5

Ribosomal protein L5

25

80

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_f clindamycin bound to the 50s subunit 0.9453 10 176
6ore-assembly1.cif.gz_E release complex 70s 0.9447 12 176
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9434 11 177
6eri-assembly1.cif.gz_AF structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor 0.9409 12 176
8a63-assembly1.cif.gz_J cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9384 12 174
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9468 12 176 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9071 20 177 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9012 20 171 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.896 20 176 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8802 12 176 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A2T2R2U5-F1-model_v4 50S ribosomal protein L5 0.9781 1 178 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1F4Y0E5-F1-model_v4 50S ribosomal protein L5 0.9679 1 177 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A831V336-F1-model_v4 50S ribosomal protein L5 0.9676 1 177 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2T2R2U5-F1-model_v4 50S ribosomal protein L5 0.9674 1 178 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7X5F6G3-F1-model_v4 50S ribosomal protein L5 0.9632 1 177 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map