F098320

General Info

Members Datasets Scaffolds Average Seq Length
118 74 236 652

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0000217|Ga0439465_0000217_7270_9342
Length 690
Sequence MAIGKQTRLFAEVKFSVGIDDRCRSLGRFTGMDMKSIRFFVGMALMLAAAPAAMAQVDVGAFIKKDKFHDIQLSPNGDYYAATVPLEDRTALAIMRRSDNVLTATVALGKNTHVSRFRWVNPERVLIAIEEKFGALDDPRPTGELYAINADGGKAELLVGFRVAGAGPGTRIQPKTVENVAAFLVDDLPGDDEHVIIAVWPFGTEPYTRAERLNVYTGRRTPVARAPVRRADFVTGNAGVVRFARGAGMDNVRKLYYRAGEGDDWKLIADEGMGGSFESAIGFSADNRTAYLQAEQSKGPDAIVAYDVATGERKQVLRDEVADPSWVIYGGGPRALMNSVPVGVGFVAGTPRRQFFDPSSKDAALYKLLENAFPGQTAVIASTTTDGKTALVEVSSDRNPGDFYLFQVDAKKADYLLSRREWFDPEKMASVRPFHMKARDGVDLHGYLTLPYGSAGKQLPMVVLPHGGPFGIADVWEFDSGVQMLAQAGYAVLQVNFRGSGGYGRWFRRAGARQWGLTMQDDVTDATRWAIQSGVADASRICIYGASYGAYAALTGVAKEPDLYKCAVGYVGVYDLPMMHTRGDTQTARWGETYLREWIGEPSEVVKVSPTNMADRIKVPVFLAAGGEDERAPIEHSELMERRLKAAGVPVETLYYKTEGHGFYTEEHQREYYTKLLDFFSRHIGGTKAK

Samples

Sample ID Description Type Environment
1 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
19 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
20 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
21 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
22 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
29 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
30 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
31 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
32 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
33 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
34 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
35 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
36 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
37 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
38 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
39 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
40 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
43 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
44 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
45 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
46 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
47 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
48 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
49 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
50 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
51 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
52 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
53 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
54 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
55 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
56 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
57 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
58 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
59 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
61 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
62 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
63 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
64 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
65 2643221695 Lysobacter sp. Root494 Isolate Unclassified
66 2818991457 Xanthomonas translucens 569 Isolate Unclassified
67 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
68 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
69 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
70 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
71 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
72 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
73 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
74 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.98
Metatranscriptomes 0
Isolates 11.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.97
Nodule 0
Rhizoplane 5.93
Rhizosphere 38.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439465_0000217 3300041413 Bacteria 15394
2 SwRhRL2b_contig_1411923 2162886007 Bacteria 8737
3 SwRhRL2b_contig_268782 2162886007 Bacteria 6287
4 rootH2_10063162 3300003320 Bacteria 4812
5 Ga0055526_1000485 3300003771 Bacteria 31543
6 Ga0055524_1006107 3300003775 Bacteria 5271
7 Ga0055524_1007452 3300003775 Bacteria 4643
8 Ga0055524_1010107 3300003775 Bacteria 3780
9 Ga0055536_1000650 3300003781 Bacteria 23543
10 Ga0055536_1006089 3300003781 Bacteria 5717
11 Ga0055536_1010299 3300003781 Bacteria 3732
12 Ga0055530_10001071 3300003791 Bacteria 21561
13 Ga0055531_10004513 3300003794 Bacteria 8453
14 Ga0055531_10007280 3300003794 Bacteria 6072
15 Ga0055531_10012787 3300003794 Bacteria 3917
16 Ga0058692_1000015 3300003856 Bacteria 295729
17 Ga0065704_10000352 3300005289 Bacteria 30138
18 Ga0070658_10042408 3300005327 Bacteria 3675
19 Ga0070670_100001701 3300005331 Bacteria 17909
20 Ga0070668_100016351 3300005347 Bacteria 5548
21 Ga0075368_10011565 3300006042 Bacteria 3213
22 Ga0105251_10001599 3300009011 Bacteria 19319
23 Ga0157370_10010606 3300013104 Bacteria 9699
24 Ga0182008_10000187 3300014497 Bacteria 48971
25 Ga0182005_1004669 3300015265 Bacteria 4380
26 Ga0163161_10004122 3300017792 Bacteria 10166
27 Ga0209673_1003811 3300025273 Bacteria 8549
28 Ga0209675_1003037 3300025291 Bacteria 8234
29 Ga0209675_1006573 3300025291 Bacteria 4631
30 Ga0209675_1006995 3300025291 Bacteria 4410
31 Ga0209676_1000027 3300025292 Bacteria 560222
32 Ga0209676_1000957 3300025292 Bacteria 35083
33 Ga0209676_1001394 3300025292 Bacteria 23377
34 Ga0209676_1003934 3300025292 Bacteria 8608
35 Ga0209676_1013609 3300025292 Bacteria 3117
36 Ga0209025_1004174 3300025294 Bacteria 12773
37 Ga0209050_1000998 3300025298 Bacteria 35642
38 Ga0209256_1001920 3300025299 Bacteria 19010
39 Ga0209256_1006374 3300025299 Bacteria 6283
40 Ga0209256_1014797 3300025299 Bacteria 2775
41 Ga0209257_1000150 3300025304 Bacteria 191487
42 Ga0209257_1000664 3300025304 Bacteria 54069
43 Ga0209257_1001788 3300025304 Bacteria 23650
44 Ga0209257_1004301 3300025304 Bacteria 11195
45 Ga0209257_1005385 3300025304 Bacteria 9018
46 Ga0209257_1007987 3300025304 Bacteria 6183
47 Ga0207650_10001485 3300025925 Bacteria 16814
48 Ga0209371_1000011 3300027312 Bacteria 848456
49 Ga0268256_1000011 3300030500 Bacteria 848625
50 Ga0316176_1132467 3300030732 Bacteria 4540
51 Ga0307414_10000179 3300032004 Bacteria 43124
52 Ga0307414_10043329 3300032004 Bacteria 3065
53 Ga0307411_10013448 3300032005 Bacteria 4516
54 Ga0395905_0143820 3300037471 Bacteria 2244
55 Ga0237819_00805 3300038705 Bacteria 9944
56 Ga0439465_0004069 3300041413 Bacteria 4762
57 Ga0451793_0498218 3300041452 Bacteria 4246
58 Ga0451800_0619644 3300041459 Bacteria 12969
59 Ga0451806_043737 3300041462 Bacteria 8737
60 Ga0451804_0141127 3300041463 Bacteria 5408
61 Ga0451807_1761826 3300041486 Bacteria 2592
62 Ga0439449_0000026 3300042007 Bacteria 43972
63 Ga0439449_0002066 3300042007 Bacteria 7902
64 Ga0439449_0005730 3300042007 Bacteria 4749
65 Ga0451577_0001588 3300042876 Bacteria 29614
66 Ga0495638_0002844 3300046460 Bacteria 13870
67 Ga0495638_0025828 3300046460 Bacteria 3814
68 Ga0495663_0000379 3300046525 Bacteria 16472
69 Ga0495663_0001779 3300046525 Bacteria 6670
70 Ga0495663_0003988 3300046525 Bacteria 4194
71 Ga0495656_0000847 3300046615 Bacteria 9876
72 Ga0495671_0011736 3300046692 Bacteria 4805
73 Ga0495660_0007982 3300046810 Bacteria 6216
74 Ga0495636_0000849 3300047318 Bacteria 11264
75 Ga0496113_0079893 3300048916 Bacteria 2504
76 Ga0496114_0001533 3300048917 Bacteria 17508
77 Ga0496116_0009454 3300048919 Bacteria 8303
78 Ga0496117_0001028 3300048920 Bacteria 42597
79 Ga0496117_0008349 3300048920 Bacteria 9845
80 Ga0496117_0048319 3300048920 Bacteria 3041
81 Ga0496118_0000944 3300048921 Bacteria 45453
82 Ga0496118_0001053 3300048921 Bacteria 43048
83 Ga0496118_0012677 3300048921 Bacteria 8062
84 Ga0496118_0034087 3300048921 Bacteria 4162
85 Ga0496118_0055635 3300048921 Bacteria 2983
86 Ga0496121_0005871 3300048924 Bacteria 15545
87 Ga0496122_0013547 3300048925 Bacteria 7968
88 Ga0496122_0025254 3300048925 Bacteria 5166
89 Ga0496123_0011157 3300048926 Bacteria 7825
90 Ga0496123_0012437 3300048926 Bacteria 7256
91 Ga0496123_0024273 3300048926 Bacteria 4613
92 Ga0496123_0029044 3300048926 Bacteria 4082
93 Ga0496123_0033497 3300048926 Bacteria 3696
94 Ga0496124_0004922 3300048927 Bacteria 15338
95 Ga0496124_0011206 3300048927 Bacteria 8987
96 Ga0496124_0025493 3300048927 Bacteria 5354
97 Ga0496124_0069091 3300048927 Bacteria 2934
98 Ga0496125_0021934 3300048928 Bacteria 5939
99 Ga0496125_0023497 3300048928 Bacteria 5689
100 Ga0496125_0036989 3300048928 Bacteria 4250
101 Ga0496126_0033446 3300048929 Bacteria 4837
102 Ga0496126_0050581 3300048929 Bacteria 3786
103 Ga0501034_0000544 3300049571 Bacteria 59969
104 Ga0501225_0008919 3300049705 Bacteria 2869
105 Ga0500565_000083 3300053734 Bacteria 4610
106 2572255428 2571042365 Bacteria 3289345
107 2578459202 2576861471 Bacteria 4648976
108 2643905498 2643221579 Bacteria 4443405
109 2644529785 2643221695 Bacteria 3441323
110 2819663789 2818991457 Bacteria 5323295
111 2852686481 2852684882 Bacteria 5463342
112 2857442948 2857442823 Bacteria 4562550
113 2919132770 2919130084 Bacteria 5301837
114 2923517614 2923516293 Bacteria 3716336
115 2929196938 2929195423 Bacteria 5325372
116 2939625116 2939622612 Bacteria 4698046
117 8021625260 8021622325 Bacteria 4844743
118 8021649727 8021648035 Bacteria 4772378
119 Ga0439465_0000217
120 SwRhRL2b_contig_1411923
121 SwRhRL2b_contig_268782
122 rootH2_10063162
123 Ga0055526_1000485
124 Ga0055524_1006107
125 Ga0055524_1007452
126 Ga0055524_1010107
127 Ga0055536_1000650
128 Ga0055536_1006089
129 Ga0055536_1010299
130 Ga0055530_10001071
131 Ga0055531_10004513
132 Ga0055531_10007280
133 Ga0055531_10012787
134 Ga0058692_1000015
135 Ga0065704_10000352
136 Ga0070658_10042408
137 Ga0070670_100001701
138 Ga0070668_100016351
139 Ga0075368_10011565
140 Ga0105251_10001599
141 Ga0157370_10010606
142 Ga0182008_10000187
143 Ga0182005_1004669
144 Ga0163161_10004122
145 Ga0209673_1003811
146 Ga0209675_1003037
147 Ga0209675_1006573
148 Ga0209675_1006995
149 Ga0209676_1000027
150 Ga0209676_1000957
151 Ga0209676_1001394
152 Ga0209676_1003934
153 Ga0209676_1013609
154 Ga0209025_1004174
155 Ga0209050_1000998
156 Ga0209256_1001920
157 Ga0209256_1006374
158 Ga0209256_1014797
159 Ga0209257_1000150
160 Ga0209257_1000664
161 Ga0209257_1001788
162 Ga0209257_1004301
163 Ga0209257_1005385
164 Ga0209257_1007987
165 Ga0207650_10001485
166 Ga0209371_1000011
167 Ga0268256_1000011
168 Ga0316176_1132467
169 Ga0307414_10000179
170 Ga0307414_10043329
171 Ga0307411_10013448
172 Ga0395905_0143820
173 Ga0237819_00805
174 Ga0439465_0004069
175 Ga0451793_0498218
176 Ga0451800_0619644
177 Ga0451806_043737
178 Ga0451804_0141127
179 Ga0451807_1761826
180 Ga0439449_0000026
181 Ga0439449_0002066
182 Ga0439449_0005730
183 Ga0451577_0001588
184 Ga0495638_0002844
185 Ga0495638_0025828
186 Ga0495663_0000379
187 Ga0495663_0001779
188 Ga0495663_0003988
189 Ga0495656_0000847
190 Ga0495671_0011736
191 Ga0495660_0007982
192 Ga0495636_0000849
193 Ga0496113_0079893
194 Ga0496114_0001533
195 Ga0496116_0009454
196 Ga0496117_0001028
197 Ga0496117_0008349
198 Ga0496117_0048319
199 Ga0496118_0000944
200 Ga0496118_0001053
201 Ga0496118_0012677
202 Ga0496118_0034087
203 Ga0496118_0055635
204 Ga0496121_0005871
205 Ga0496122_0013547
206 Ga0496122_0025254
207 Ga0496123_0011157
208 Ga0496123_0012437
209 Ga0496123_0024273
210 Ga0496123_0029044
211 Ga0496123_0033497
212 Ga0496124_0004922
213 Ga0496124_0011206
214 Ga0496124_0025493
215 Ga0496124_0069091
216 Ga0496125_0021934
217 Ga0496125_0023497
218 Ga0496125_0036989
219 Ga0496126_0033446
220 Ga0496126_0050581
221 Ga0501034_0000544
222 Ga0501225_0008919
223 Ga0500565_000083
224 2572255428
225 2578459202
226 2643905498
227 2644529785
228 2819663789
229 2852686481
230 2857442948
231 2919132770
232 2923517614
233 2929196938
234 2939625116
235 8021625260
236 8021649727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

476

687

0.96

PF01738

DLH

Dienelactone hydrolase family

444

678

0.83

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

440

605

0.83

PF20434

BD-FAE

BD-FAE

448

644

0.8

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

462

665

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8076 382 629
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7978 382 629
7q4h-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex with pmsf 0.795 382 636
7wwh-assembly2.cif.gz_B crystal structure of the geobacillus thermoglucosidasius feruloyl esterase gthfae 0.7844 384 633
7q4h-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex with pmsf 0.7839 382 636
ID Description Score Start End Superfamily
af_P34422_345_662_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9145 347 638 3.40.50.1820
4re6B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9061 378 635 3.40.50.1820
af_Q69Y12_406_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8911 378 643 3.40.50.1820
af_Q69Y12_406_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8847 378 643 3.40.50.1820
2z3wA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8829 380 636 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A494TNG4-F1-model_v4 S9 family peptidase 0.9507 434 636 GO:0004252
GO:0006508
AF-A0A7W2U3H0-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9498 466 635 GO:0004252
GO:0006508
AF-U1JHA9-F1-model_v4 Peptidase S9 prolyl oligopeptidase 0.9428 23 636 GO:0004252
GO:0006508
AF-A0A6L4Z6D7-F1-model_v4 Dipeptidyl aminopeptidase/acylaminoacyl-peptidase 0.9404 384 646 GO:0004177
GO:0004252
GO:0006508
AF-A0A522XYU4-F1-model_v4 S9 family peptidase 0.9403 18 648 GO:0004252
GO:0006508

Map