F100473

General Info

Members Datasets Scaffolds Average Seq Length
119 93 238 252

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100130769|Ga0070688_1001307692
Length 260
Sequence MVGGGMDKDNETILEVKNLRKRYGDKEVVKGISFEVKRGEVFGILGPNGAGKTTTFEMIEAMRSIDGGEITVDGIDVQKDPWAVRRIIGVQPQSPSFQDKQKLSEIIEMFAATYGERVNVQEFLDDVNLGEKINDFAENLSGGQRQRLSIAAALVHNPRVFFLDEPTTGLDPQARRNLWKLIEHIRDKGVTVMLTTHYMDEAEILCDRVAIMDRGQIIQLDTPKNLIKQLLAKGFKKEQKVEQANLEDVFIDLTGKALRD

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
81 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
82 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
83 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
84 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
85 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
86 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
87 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
88 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
89 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
90 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
91 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
92 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
93 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.49
Nodule 0
Rhizoplane 0.84
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100130769 3300005365 Bacteria 1693
2 JGI24742J22300_10000174 3300002244 Bacteria 9518
3 rootH2_10000311 3300003320 Bacteria 277677
4 rootH2_10097681 3300003320 Bacteria 2766
5 Ga0070658_10000051 3300005327 Bacteria 118657
6 Ga0070658_10000339 3300005327 Bacteria 40406
7 Ga0070676_10000888 3300005328 Bacteria 14766
8 Ga0070683_100891215 3300005329 Bacteria 853
9 Ga0070690_100000608 3300005330 Bacteria 18106
10 Ga0070682_100000500 3300005337 Bacteria 24620
11 Ga0070660_100000054 3300005339 Bacteria 67207
12 Ga0070668_100097342 3300005347 Bacteria 2327
13 Ga0070674_100006252 3300005356 Bacteria 6932
14 Ga0070667_100004243 3300005367 Bacteria 12104
15 Ga0070667_100116671 3300005367 Bacteria 2319
16 Ga0070678_100044006 3300005456 Bacteria 3185
17 Ga0070681_10044073 3300005458 Bacteria 4465
18 Ga0070685_10000637 3300005466 Bacteria 19172
19 Ga0070679_100035879 3300005530 Bacteria 4920
20 Ga0070679_100144726 3300005530 Bacteria 2355
21 Ga0070696_100036133 3300005546 Bacteria 3405
22 Ga0070665_100168580 3300005548 Bacteria 2191
23 Ga0068855_100000001 3300005563 Bacteria 818777
24 Ga0068855_100005226 3300005563 Bacteria 15838
25 Ga0070664_100091051 3300005564 Bacteria 2640
26 Ga0068863_100693080 3300005841 Bacteria 1012
27 Ga0068858_100139788 3300005842 Bacteria 2273
28 Ga0068860_100086677 3300005843 Bacteria 2980
29 Ga0068860_100233212 3300005843 Bacteria 1789
30 Ga0068862_100334211 3300005844 Bacteria 1402
31 Ga0081455_10000008 3300005937 Bacteria 256558
32 Ga0075365_10000016 3300006038 Bacteria 71640
33 Ga0075365_10065848 3300006038 Bacteria 2429
34 Ga0075364_10113880 3300006051 Bacteria 1807
35 Ga0075369_10000006 3300006186 Bacteria 132271
36 Ga0075366_10000158 3300006195 Bacteria 28657
37 Ga0097621_100000001 3300006237 Bacteria 632268
38 Ga0068871_100001673 3300006358 Bacteria 14907
39 Ga0105240_10000048 3300009093 Bacteria 237451
40 Ga0105245_10048317 3300009098 Bacteria 3806
41 Ga0105247_10197927 3300009101 Bacteria 1348
42 Ga0105241_10000009 3300009174 Bacteria 258876
43 Ga0105241_10000372 3300009174 Bacteria 34165
44 Ga0105248_10064413 3300009177 Bacteria 4115
45 Ga0105237_10467899 3300009545 Bacteria 1267
46 Ga0105249_10006007 3300009553 Bacteria 10521
47 Ga0105249_11022812 3300009553 Bacteria 895
48 Ga0157371_10069043 3300013102 Bacteria 2502
49 Ga0157369_10000054 3300013105 Bacteria 162631
50 Ga0157369_10273519 3300013105 Bacteria 1760
51 Ga0157378_10334008 3300013297 Bacteria 1476
52 Ga0157372_10000143 3300013307 Bacteria 78295
53 Ga0157372_10089141 3300013307 Bacteria 3504
54 Ga0163163_10012972 3300014325 Bacteria 7612
55 Ga0163163_10084428 3300014325 Bacteria 3181
56 Ga0157377_10025074 3300014745 Unclassified 3178
57 Ga0207645_10028194 3300025907 Bacteria 3626
58 Ga0207705_10000019 3300025909 Bacteria 317770
59 Ga0207705_10000057 3300025909 Bacteria 157369
60 Ga0207654_10000002 3300025911 Bacteria 1460142
61 Ga0207654_10001347 3300025911 Bacteria 13029
62 Ga0207695_10006638 3300025913 Bacteria 14938
63 Ga0207657_10003406 3300025919 Bacteria 16987
64 Ga0207652_10079550 3300025921 Bacteria 2864
65 Ga0207669_10003223 3300025937 Bacteria 7052
66 Ga0207667_10000003 3300025949 Bacteria 822935
67 Ga0207667_10017600 3300025949 Bacteria 8037
68 Ga0207712_10018911 3300025961 Bacteria 4494
69 Ga0207712_10610398 3300025961 Bacteria 944
70 Ga0207668_10071308 3300025972 Bacteria 2481
71 Ga0207658_10008443 3300025986 Bacteria 7010
72 Ga0207658_10018716 3300025986 Bacteria 4787
73 Ga0207703_10303015 3300026035 Bacteria 1458
74 Ga0207641_10770621 3300026088 Bacteria 950
75 Ga0207674_10011293 3300026116 Bacteria 10038
76 Ga0207683_10055868 3300026121 Bacteria 3462
77 Ga0268266_10000942 3300028379 Bacteria 37115
78 Ga0268265_10286292 3300028380 Bacteria 1477
79 Ga0268264_10206155 3300028381 Bacteria 1802
80 Ga0265319_1027655 3300028563 Bacteria 2008
81 Ga0265327_10000025 3300031251 Bacteria 380054
82 Ga0265327_10001779 3300031251 Bacteria 25400
83 Ga0265327_10087658 3300031251 Bacteria 1524
84 Ga0395900_0002550 3300037418 Bacteria 19962
85 Ga0395900_0076134 3300037418 Bacteria 3449
86 Ga0395900_0082156 3300037418 Unclassified 3310
87 Ga0395898_0018801 3300037466 Bacteria 7040
88 Ga0395905_0129455 3300037471 Bacteria 2374
89 Ga0395901_0001706 3300038443 Bacteria 22691
90 Ga0451793_0554050 3300041452 Bacteria 1439
91 Ga0466963_0050523 3300044694 Bacteria 2752
92 Ga0501033_0020240 3300049570 Bacteria 5030
93 Ga0501034_0000024 3300049571 Bacteria 263735
94 Ga0501034_0002390 3300049571 Bacteria 22779
95 Ga0501034_0357869 3300049571 Bacteria 1387
96 Ga0501036_0086640 3300049572 Bacteria 2647
97 Ga0501037_0022572 3300049573 Bacteria 4654
98 Ga0501047_0000024 3300049581 Bacteria 230397
99 Ga0501048_0078468 3300049582 Bacteria 2330
100 Ga0501083_0024971 3300049744 Bacteria 4139
101 Ga0501035_0000005 3300049822 Bacteria 392980
102 Ga0501044_0001150 3300049823 Bacteria 31351
103 nmdc:mga00v17_20322_c1 3300050491 Bacteria 3802
104 nmdc:mga0yw44_66878_c1 3300050492 Bacteria 2219
105 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
106 nmdc:mga0k408_47_c1 3300050493 Bacteria 61154
107 nmdc:mga07m45_1481_c1 3300050496 Bacteria 10786
108 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
109 Ga0500644_0009699 3300053088 Bacteria 2584
110 Ga0500583_0000105 3300053092 Bacteria 44085
111 Ga0500555_000001 3300053103 Bacteria 1353713
112 Ga0500556_0000369 3300053104 Bacteria 32993
113 Ga0500556_0062300 3300053104 Bacteria 1376
114 Ga0500562_000002 3300053108 Bacteria 977234
115 Ga0500594_0000070 3300053118 Bacteria 32225
116 Ga0500628_000018 3300053129 Bacteria 85560
117 Ga0500628_011850 3300053129 Bacteria 1593
118 Ga0500642_0144759 3300053130 Bacteria 1115
119 Ga0500589_000003 3300053147 Bacteria 220717
120 Ga0070688_100130769
121 JGI24742J22300_10000174
122 rootH2_10000311
123 rootH2_10097681
124 Ga0070658_10000051
125 Ga0070658_10000339
126 Ga0070676_10000888
127 Ga0070683_100891215
128 Ga0070690_100000608
129 Ga0070682_100000500
130 Ga0070660_100000054
131 Ga0070668_100097342
132 Ga0070674_100006252
133 Ga0070667_100004243
134 Ga0070667_100116671
135 Ga0070678_100044006
136 Ga0070681_10044073
137 Ga0070685_10000637
138 Ga0070679_100035879
139 Ga0070679_100144726
140 Ga0070696_100036133
141 Ga0070665_100168580
142 Ga0068855_100000001
143 Ga0068855_100005226
144 Ga0070664_100091051
145 Ga0068863_100693080
146 Ga0068858_100139788
147 Ga0068860_100086677
148 Ga0068860_100233212
149 Ga0068862_100334211
150 Ga0081455_10000008
151 Ga0075365_10000016
152 Ga0075365_10065848
153 Ga0075364_10113880
154 Ga0075369_10000006
155 Ga0075366_10000158
156 Ga0097621_100000001
157 Ga0068871_100001673
158 Ga0105240_10000048
159 Ga0105245_10048317
160 Ga0105247_10197927
161 Ga0105241_10000009
162 Ga0105241_10000372
163 Ga0105248_10064413
164 Ga0105237_10467899
165 Ga0105249_10006007
166 Ga0105249_11022812
167 Ga0157371_10069043
168 Ga0157369_10000054
169 Ga0157369_10273519
170 Ga0157378_10334008
171 Ga0157372_10000143
172 Ga0157372_10089141
173 Ga0163163_10012972
174 Ga0163163_10084428
175 Ga0157377_10025074
176 Ga0207645_10028194
177 Ga0207705_10000019
178 Ga0207705_10000057
179 Ga0207654_10000002
180 Ga0207654_10001347
181 Ga0207695_10006638
182 Ga0207657_10003406
183 Ga0207652_10079550
184 Ga0207669_10003223
185 Ga0207667_10000003
186 Ga0207667_10017600
187 Ga0207712_10018911
188 Ga0207712_10610398
189 Ga0207668_10071308
190 Ga0207658_10008443
191 Ga0207658_10018716
192 Ga0207703_10303015
193 Ga0207641_10770621
194 Ga0207674_10011293
195 Ga0207683_10055868
196 Ga0268266_10000942
197 Ga0268265_10286292
198 Ga0268264_10206155
199 Ga0265319_1027655
200 Ga0265327_10000025
201 Ga0265327_10001779
202 Ga0265327_10087658
203 Ga0395900_0002550
204 Ga0395900_0076134
205 Ga0395900_0082156
206 Ga0395898_0018801
207 Ga0395905_0129455
208 Ga0395901_0001706
209 Ga0451793_0554050
210 Ga0466963_0050523
211 Ga0501033_0020240
212 Ga0501034_0000024
213 Ga0501034_0002390
214 Ga0501034_0357869
215 Ga0501036_0086640
216 Ga0501037_0022572
217 Ga0501047_0000024
218 Ga0501048_0078468
219 Ga0501083_0024971
220 Ga0501035_0000005
221 Ga0501044_0001150
222 nmdc:mga00v17_20322_c1
223 nmdc:mga0yw44_66878_c1
224 nmdc:mga0yw44_7_c1
225 nmdc:mga0k408_47_c1
226 nmdc:mga07m45_1481_c1
227 nmdc:mga0sz30_2_c1
228 Ga0500644_0009699
229 Ga0500583_0000105
230 Ga0500555_000001
231 Ga0500556_0000369
232 Ga0500556_0062300
233 Ga0500562_000002
234 Ga0500594_0000070
235 Ga0500628_000018
236 Ga0500628_011850
237 Ga0500642_0144759
238 Ga0500589_000003

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

168

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

93

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9362 2 213
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.9353 3 222
8eeb-assembly1.cif.gz_A cryo-em structure of human abca7 in digitonin 0.9301 3 218
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9286 1 249
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9224 3 221
ID Description Score Start End Superfamily
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9492 2 221 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 2 207 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9355 4 217 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 1 219 3.40.50.300
af_Q54R52_468_723_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9324 3 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X0I8X8-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.965 2 221 GO:0005524
GO:0016887
GO:0046677
AF-A0A820X1S1-F1-model_v4 ABC transporter domain-containing protein 0.9632 2 220 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-L9X2C7-F1-model_v4 ABC transporter-like protein 0.9626 2 221 GO:0005524
GO:0016887
AF-A0A7G9REB6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9619 1 220 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A2S6WL76-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9611 1 219 GO:0005524
GO:0016887
GO:0046677

Map