F106953

General Info

Members Datasets Scaffolds Average Seq Length
120 96 240 78

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0129835|Ga0451853_0129835_168_416
Length 82
Sequence MSDSETRRGAVEALARVLGFDQPELSCEECFAQLGRYVELALAGDARPDEQVPGMRAHLEGCPACAEDYRSLRDLVSGEAES

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
91 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
92 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
95 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 3.33
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_0129835 3300041512 Bacteria 591
2 LJQas_1003663 3300000549 Unclassified 2041
3 JGI24740J21852_10003498 3300001979 Bacteria 6886
4 Ga0070683_100005444 3300005329 Bacteria 10634
5 Ga0070683_100019594 3300005329 Bacteria 6011
6 Ga0070683_101689035 3300005329 Bacteria 609
7 Ga0070680_100014015 3300005336 Bacteria 6258
8 Ga0070689_100071937 3300005340 Bacteria 2702
9 Ga0070661_100000031 3300005344 Bacteria 113816
10 Ga0070668_101851897 3300005347 Bacteria 555
11 Ga0070688_100000064 3300005365 Bacteria 52662
12 Ga0070688_100041633 3300005365 Bacteria 2821
13 Ga0070713_100040878 3300005436 Bacteria 3773
14 Ga0070713_100559066 3300005436 Bacteria 1084
15 Ga0070711_100042971 3300005439 Bacteria 3058
16 Ga0070711_100633043 3300005439 Bacteria 895
17 Ga0070681_10021223 3300005458 Bacteria 6508
18 Ga0070685_10000154 3300005466 Bacteria 45505
19 Ga0070685_10820808 3300005466 Bacteria 687
20 Ga0070679_100000898 3300005530 Bacteria 25832
21 Ga0070684_100006020 3300005535 Bacteria 9344
22 Ga0070684_100044773 3300005535 Bacteria 3829
23 Ga0070684_100650895 3300005535 Bacteria 981
24 Ga0068853_100000104 3300005539 Bacteria 56511
25 Ga0068853_100262905 3300005539 Bacteria 1587
26 Ga0070665_100000308 3300005548 Bacteria 76310
27 Ga0070665_100083315 3300005548 Bacteria 3203
28 Ga0070664_100442659 3300005564 Bacteria 1192
29 Ga0068856_100002922 3300005614 Bacteria 17503
30 Ga0068852_100011665 3300005616 Bacteria 6628
31 Ga0068858_100000066 3300005842 Bacteria 108011
32 Ga0068860_101089717 3300005843 Bacteria 818
33 Ga0068862_100008815 3300005844 Bacteria 8351
34 Ga0081540_1121360 3300005983 Unclassified 1084
35 Ga0070717_10029665 3300006028 Bacteria 4390
36 Ga0070712_100010126 3300006175 Bacteria 5941
37 Ga0070712_101680347 3300006175 Unclassified 556
38 Ga0070712_101929950 3300006175 Bacteria 517
39 Ga0075367_10329697 3300006178 Bacteria 962
40 Ga0105245_10005216 3300009098 Bacteria 11414
41 Ga0105249_10004993 3300009553 Bacteria 11450
42 Ga0105249_10342374 3300009553 Bacteria 1512
43 Ga0105239_10239289 3300010375 Bacteria 2037
44 Ga0157370_10049366 3300013104 Bacteria 4028
45 Ga0157374_11678872 3300013296 Bacteria 660
46 Ga0157378_10001813 3300013297 Bacteria 19166
47 Ga0157375_10001556 3300013308 Bacteria 19758
48 Ga0157379_10013377 3300014968 Bacteria 7186
49 Ga0206354_10903151 3300020081 Bacteria 542
50 Ga0207692_10229163 3300025898 Bacteria 1105
51 Ga0207685_10154257 3300025905 Bacteria 1042
52 Ga0207707_10039592 3300025912 Bacteria 4120
53 Ga0207693_10012837 3300025915 Bacteria 6757
54 Ga0207663_10013486 3300025916 Bacteria 4443
55 Ga0207660_10009025 3300025917 Bacteria 6454
56 Ga0207649_10000021 3300025920 Bacteria 209660
57 Ga0207652_10000408 3300025921 Bacteria 44642
58 Ga0207687_10002658 3300025927 Bacteria 12091
59 Ga0207700_10934405 3300025928 Bacteria 776
60 Ga0207664_10117193 3300025929 Bacteria 2223
61 Ga0207670_10052306 3300025936 Bacteria 2746
62 Ga0207661_10000883 3300025944 Bacteria 19704
63 Ga0207661_10001822 3300025944 Bacteria 14565
64 Ga0207679_10385940 3300025945 Bacteria 1229
65 Ga0207667_10222098 3300025949 Bacteria 1936
66 Ga0207712_10000037 3300025961 Bacteria 195906
67 Ga0207712_10019910 3300025961 Bacteria 4388
68 Ga0207712_10446568 3300025961 Bacteria 1096
69 Ga0207668_10133314 3300025972 Bacteria 1900
70 Ga0207703_10000054 3300026035 Bacteria 143734
71 Ga0207639_10000644 3300026041 Bacteria 24030
72 Ga0207639_10235335 3300026041 Bacteria 1590
73 Ga0207702_10005043 3300026078 Bacteria 11600
74 Ga0268266_10000099 3300028379 Bacteria 182294
75 Ga0268266_10026324 3300028379 Bacteria 4949
76 Ga0268265_10001203 3300028380 Bacteria 22514
77 Ga0268264_10235624 3300028381 Bacteria 1693
78 Ga0307410_12111396 3300031852 Bacteria 504
79 Ga0307416_100283593 3300032002 Bacteria 1635
80 Ga0373957_0080401 3300035120 Unclassified 1286
81 Ga0373955_0929798 3300035172 Unclassified 535
82 Ga0373937_0030429 3300036401 Bacteria 4890
83 Ga0395899_0561986 3300037312 Unclassified 732
84 Ga0395900_0520581 3300037418 Bacteria 1137
85 Ga0395898_0218098 3300037466 Bacteria 1820
86 Ga0395901_0160788 3300038443 Bacteria 2359
87 Ga0466966_0334675 3300044684 Bacteria 910
88 Ga0466964_0304795 3300044706 Bacteria 804
89 Ga0466970_0027361 3300044765 Bacteria 2993
90 Ga0466957_0122931 3300044842 Bacteria 1656
91 Ga0466957_0234722 3300044842 Bacteria 1215
92 Ga0466957_0534060 3300044842 Bacteria 816
93 Ga0466959_0009023 3300045049 Bacteria 7073
94 Ga0466958_0021581 3300045836 Bacteria 3765
95 Ga0466958_0023565 3300045836 Bacteria 3615
96 Ga0466958_0379680 3300045836 Bacteria 911
97 Ga0466967_0000007 3300045976 Bacteria 135597
98 Ga0495606_0000082 3300046507 Bacteria 159585
99 Ga0495608_0005252 3300046511 Bacteria 9252
100 Ga0495587_0007390 3300046536 Bacteria 7117
101 Ga0495657_0006356 3300046675 Bacteria 9252
102 Ga0495669_0121564 3300046684 Bacteria 1224
103 Ga0495613_0000655 3300046689 Bacteria 27450
104 Ga0495613_0027995 3300046689 Bacteria 4195
105 Ga0495600_0281585 3300046809 Bacteria 1052
106 Ga0495675_0003694 3300047444 Bacteria 9252
107 Ga0495602_0000008 3300048088 Bacteria 260157
108 Ga0496108_0073157 3300048911 Bacteria 2894
109 Ga0496109_0000046 3300048912 Bacteria 131025
110 Ga0496112_0000648 3300048915 Bacteria 24159
111 Ga0496113_0579948 3300048916 Bacteria 899
112 Ga0501044_1024191 3300049823 Bacteria 697
113 Ga0495612_0082332 3300053078 Bacteria 1353
114 Ga0495655_0276009 3300053083 Bacteria 571
115 Ga0495595_0001450 3300053084 Bacteria 9252
116 Ga0495619_0004160 3300053085 Bacteria 9249
117 Ga0590075_111355 3300059424 Bacteria 715
118 Ga0466962_0021912 3300061719 Bacteria 3068
119 Ga0466962_0131114 3300061719 Bacteria 1211
120 Ga0530510_0570224 3300061734 Bacteria 860
121 Ga0451853_0129835
122 LJQas_1003663
123 JGI24740J21852_10003498
124 Ga0070683_100005444
125 Ga0070683_100019594
126 Ga0070683_101689035
127 Ga0070680_100014015
128 Ga0070689_100071937
129 Ga0070661_100000031
130 Ga0070668_101851897
131 Ga0070688_100000064
132 Ga0070688_100041633
133 Ga0070713_100040878
134 Ga0070713_100559066
135 Ga0070711_100042971
136 Ga0070711_100633043
137 Ga0070681_10021223
138 Ga0070685_10000154
139 Ga0070685_10820808
140 Ga0070679_100000898
141 Ga0070684_100006020
142 Ga0070684_100044773
143 Ga0070684_100650895
144 Ga0068853_100000104
145 Ga0068853_100262905
146 Ga0070665_100000308
147 Ga0070665_100083315
148 Ga0070664_100442659
149 Ga0068856_100002922
150 Ga0068852_100011665
151 Ga0068858_100000066
152 Ga0068860_101089717
153 Ga0068862_100008815
154 Ga0081540_1121360
155 Ga0070717_10029665
156 Ga0070712_100010126
157 Ga0070712_101680347
158 Ga0070712_101929950
159 Ga0075367_10329697
160 Ga0105245_10005216
161 Ga0105249_10004993
162 Ga0105249_10342374
163 Ga0105239_10239289
164 Ga0157370_10049366
165 Ga0157374_11678872
166 Ga0157378_10001813
167 Ga0157375_10001556
168 Ga0157379_10013377
169 Ga0206354_10903151
170 Ga0207692_10229163
171 Ga0207685_10154257
172 Ga0207707_10039592
173 Ga0207693_10012837
174 Ga0207663_10013486
175 Ga0207660_10009025
176 Ga0207649_10000021
177 Ga0207652_10000408
178 Ga0207687_10002658
179 Ga0207700_10934405
180 Ga0207664_10117193
181 Ga0207670_10052306
182 Ga0207661_10000883
183 Ga0207661_10001822
184 Ga0207679_10385940
185 Ga0207667_10222098
186 Ga0207712_10000037
187 Ga0207712_10019910
188 Ga0207712_10446568
189 Ga0207668_10133314
190 Ga0207703_10000054
191 Ga0207639_10000644
192 Ga0207639_10235335
193 Ga0207702_10005043
194 Ga0268266_10000099
195 Ga0268266_10026324
196 Ga0268265_10001203
197 Ga0268264_10235624
198 Ga0307410_12111396
199 Ga0307416_100283593
200 Ga0373957_0080401
201 Ga0373955_0929798
202 Ga0373937_0030429
203 Ga0395899_0561986
204 Ga0395900_0520581
205 Ga0395898_0218098
206 Ga0395901_0160788
207 Ga0466966_0334675
208 Ga0466964_0304795
209 Ga0466970_0027361
210 Ga0466957_0122931
211 Ga0466957_0234722
212 Ga0466957_0534060
213 Ga0466959_0009023
214 Ga0466958_0021581
215 Ga0466958_0023565
216 Ga0466958_0379680
217 Ga0466967_0000007
218 Ga0495606_0000082
219 Ga0495608_0005252
220 Ga0495587_0007390
221 Ga0495657_0006356
222 Ga0495669_0121564
223 Ga0495613_0000655
224 Ga0495613_0027995
225 Ga0495600_0281585
226 Ga0495675_0003694
227 Ga0495602_0000008
228 Ga0496108_0073157
229 Ga0496109_0000046
230 Ga0496112_0000648
231 Ga0496113_0579948
232 Ga0501044_1024191
233 Ga0495612_0082332
234 Ga0495655_0276009
235 Ga0495595_0001450
236 Ga0495619_0004160
237 Ga0590075_111355
238 Ga0466962_0021912
239 Ga0466962_0131114
240 Ga0530510_0570224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.5567 31 78
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.4929 31 78
5xy3-assembly1.cif.gz_i large subunit of trichomonas vaginalis ribosome 0.3876 1 74
6em3-assembly1.cif.gz_i state a architectural model (nsa1-tap flag-ytm1) - visualizing the assembly pathway of nucleolar pre-60s ribosomes 0.3718 1 75
2e2a-assembly1.cif.gz_B asp81leu enzyme iia from the lactose specific pts from lactococcus lactis 0.3664 26 78
ID Description Score Start End Superfamily
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5567 31 78 1.10.10.1320
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.4929 31 78 1.10.10.1320
4mbqC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4488 21 68 1.20.58.2200
4mbqC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4291 21 68 1.20.58.2200
af_I1J4E0_169_270_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3792 7 57 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7C3BSI7-F1-model_v4 Zf-HC2 domain-containing protein 0.9065 20 78
AF-A0A538CRS3-F1-model_v4 Zf-HC2 domain-containing protein 0.8994 20 78
AF-A0A661W3Z6-F1-model_v4 Zinc-finger domain-containing protein 0.8406 19 78
AF-A0A7V4SQ21-F1-model_v4 Putative zinc-finger domain-containing protein 0.8231 23 78
AF-A0A7V9PQH1-F1-model_v4 Zf-HC2 domain-containing protein 0.8208 7 78

Map