F123441

General Info

Members Datasets Scaffolds Average Seq Length
124 106 79 223

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0050584|Ga0439465_0050584_213_974
Length 235
Sequence MNEILDWILDTVESVDPVMRTLLAGLGIMLETSVLIGLVVPGDTIVLVASTAVDSTAEYFALTRWFGPHILRSRLGRKIGEDNWHRAQRYLDRRGGPAIFISRFLPVLHSLIPLTVGMSTMRYRRFIAWTVPACVIWAFAYVTVGWLAAGSYRELSRSLHWAGYVFVGIIAAFLLVVWGVKKLLIRSEAKHMAAIDEIGRLDEVDGDGFDAAGGGADDEGPDATASDPSNLDAER

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
4 2643221575 Microbacterium sp. Root61 Isolate Unclassified
5 2643221597 Microbacterium sp. Root180 Isolate Unclassified
6 2643221616 Leifsonia sp. Root227 Isolate Unclassified
7 2643221630 Microbacterium sp. Root322 Isolate Unclassified
8 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
9 2643221649 Leifsonia sp. Root4 Isolate Unclassified
10 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
11 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
12 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
13 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
14 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
15 2808606372 Agromyces sp. 23-23 Isolate Unclassified
16 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
17 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
18 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
19 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
20 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
21 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
22 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
23 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
24 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
25 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
26 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
27 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
28 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
29 2919395869 Microbacterium resistens 2980 Isolate Unclassified
30 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
31 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
32 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
33 2928153084 Leifsonia sp. 563 Isolate Unclassified
34 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
35 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
36 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
37 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
38 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
39 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
40 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
41 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
42 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
43 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
83 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
84 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
87 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
99 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
100 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
101 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
102 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
103 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
104 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
105 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
106 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.9
Metatranscriptomes 0.81
Isolates 36.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 6.45
Nodule 0
Rhizoplane 0
Rhizosphere 69.35
Stem 0
Stem Tuber 0
Unclassified 23.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000841 3300002067 Bacteria 10938
2 Ga0006562J51391_1006772 3300003578 Bacteria 3000
3 Ga0070670_100192444 3300005331 Bacteria 1772
4 Ga0070671_100194275 3300005355 Bacteria 1720
5 Ga0068853_100003819 3300005539 Bacteria 11537
6 Ga0068853_100520100 3300005539 Bacteria 1125
7 Ga0068857_100000341 3300005577 Bacteria 32194
8 Ga0068856_100053474 3300005614 Bacteria 3981
9 Ga0068852_100322546 3300005616 Bacteria 1500
10 Ga0068851_10000003 3300005834 Bacteria 293018
11 Ga0068858_100000709 3300005842 Bacteria 34769
12 Ga0105240_10032342 3300009093 Bacteria 6774
13 Ga0105240_10132426 3300009093 Bacteria 2989
14 Ga0105237_10000131 3300009545 Bacteria 105010
15 Ga0105238_10025792 3300009551 Bacteria 5993
16 Ga0105239_10050779 3300010375 Bacteria 4547
17 Ga0105239_10158014 3300010375 Bacteria 2532
18 Ga0157371_10019405 3300013102 Bacteria 5016
19 Ga0157369_10170547 3300013105 Bacteria 2293
20 Ga0207656_10000002 3300025321 Bacteria 792178
21 Ga0207705_10023358 3300025909 Bacteria 4411
22 Ga0207705_10154077 3300025909 Bacteria 1723
23 Ga0207695_10009341 3300025913 Bacteria 12129
24 Ga0207695_10018061 3300025913 Bacteria 8166
25 Ga0207671_10000002 3300025914 Bacteria 1144816
26 Ga0207657_10095534 3300025919 Bacteria 2473
27 Ga0207694_10000153 3300025924 Bacteria 71753
28 Ga0207650_10245461 3300025925 Bacteria 1448
29 Ga0207664_10261407 3300025929 Bacteria 1514
30 Ga0207690_10007620 3300025932 Bacteria 6422
31 Ga0207667_10078646 3300025949 Bacteria 3418
32 Ga0207703_10000031 3300026035 Bacteria 196940
33 Ga0207639_10023630 3300026041 Bacteria 4440
34 Ga0207639_10240352 3300026041 Bacteria 1574
35 Ga0207702_10100691 3300026078 Bacteria 2550
36 Ga0207702_10236046 3300026078 Bacteria 1711
37 Ga0207674_10001152 3300026116 Bacteria 34252
38 Ga0207698_10017011 3300026142 Bacteria 4922
39 Ga0207698_10499615 3300026142 Bacteria 1183
40 Ga0439465_0050584 3300041413 Bacteria 1360
41 Ga0466965_0000002 3300044683 Bacteria 297957
42 Ga0466961_0040307 3300044693 Bacteria 2994
43 Ga0466971_0008680 3300044719 Bacteria 4434
44 Ga0466970_0026925 3300044765 Bacteria 3014
45 Ga0466960_0015121 3300044901 Bacteria 3322
46 Ga0466959_0011675 3300045049 Bacteria 6317
47 Ga0495650_0000865 3300046471 Bacteria 36187
48 Ga0495644_0043339 3300046523 Bacteria 1693
49 Ga0495656_0178540 3300046615 Bacteria 1042
50 Ga0495686_0012437 3300047472 Bacteria 5952
51 Ga0496117_0000084 3300048920 Bacteria 214308
52 Ga0496117_0005139 3300048920 Bacteria 13972
53 Ga0496117_0251088 3300048920 Bacteria 965
54 Ga0496122_0005083 3300048925 Bacteria 15877
55 Ga0496123_0024015 3300048926 Bacteria 4648
56 Ga0496124_0097008 3300048927 Bacteria 2394
57 Ga0501031_0074169 3300049568 Bacteria 2216
58 Ga0501032_0075200 3300049569 Bacteria 2249
59 Ga0501033_0020565 3300049570 Bacteria 4987
60 Ga0501033_0045262 3300049570 Bacteria 3275
61 Ga0501034_0038459 3300049571 Bacteria 4844
62 Ga0501034_0202315 3300049571 Bacteria 1943
63 Ga0501036_0254134 3300049572 Bacteria 1472
64 Ga0501038_0004879 3300049574 Bacteria 12461
65 Ga0501038_0120657 3300049574 Bacteria 2163
66 Ga0501039_0056050 3300049575 Bacteria 3053
67 Ga0501039_0106486 3300049575 Bacteria 2190
68 Ga0501068_0055894 3300049584 Bacteria 2392
69 Ga0501070_0000835 3300049586 Bacteria 28002
70 Ga0501070_0036132 3300049586 Bacteria 4126
71 Ga0501073_0230394 3300049589 Bacteria 1280
72 Ga0500559_0000197 3300053136 Bacteria 48317
73 Ga0500559_0072923 3300053136 Bacteria 1548
74 Ga0500568_0001255 3300053139 Bacteria 16787
75 Ga0500573_0000106 3300053140 Bacteria 35262
76 Ga0500573_0087746 3300053140 Bacteria 1761
77 Ga0500573_0217472 3300053140 Bacteria 1004
78 Ga0500577_0017365 3300053142 Bacteria 2290
79 Ga0500616_0000071 3300053153 Bacteria 232527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10032342 Ga0105240_100323422 206
2 3300025913 Ga0207695_10018061 Ga0207695_100180612 206
3 3300041413 Ga0439465_0050584 Ga0439465_0050584_213_974 206
4 3300013102 Ga0157371_10019405 Ga0157371_100194056 209
5 iso_pu_bacteria 2946033335 2946033577 209
6 3300053136 Ga0500559_0000197 Ga0500559_0000197_13743_14420 210
7 iso_pu_bacteria 2643221724 2644680448 210
8 iso_pu_bacteria 2728369380 2730229902 210
9 3300005539 Ga0068853_100520100 Ga0068853_1005201001 211
10 3300026041 Ga0207639_10240352 Ga0207639_102403522 211
11 3300049568 Ga0501031_0074169 Ga0501031_0074169_732_1421 211
12 3300049570 Ga0501033_0045262 Ga0501033_0045262_1624_2313 211
13 3300049574 Ga0501038_0004879 Ga0501038_0004879_10493_11182 211
14 3300049575 Ga0501039_0106486 Ga0501039_0106486_414_1103 211
15 3300026078 Ga0207702_10236046 Ga0207702_102360462 212
16 3300044765 Ga0466970_0026925 Ga0466970_0026925_671_1426 212
17 3300005577 Ga0068857_100000341 Ga0068857_10000034116 213
18 3300005834 Ga0068851_10000003 Ga0068851_1000000334 213
19 3300005842 Ga0068858_100000709 Ga0068858_10000070919 213
20 3300009093 Ga0105240_10132426 Ga0105240_101324263 213
21 3300009545 Ga0105237_10000131 Ga0105237_1000013134 213
22 3300009551 Ga0105238_10025792 Ga0105238_100257923 213
23 3300010375 Ga0105239_10050779 Ga0105239_100507792 213
24 3300010375 Ga0105239_10158014 Ga0105239_101580143 213
25 3300025321 Ga0207656_10000002 Ga0207656_10000002203 213
26 3300025909 Ga0207705_10154077 Ga0207705_101540771 213
27 3300025913 Ga0207695_10009341 Ga0207695_100093414 213
28 3300025914 Ga0207671_10000002 Ga0207671_10000002497 213
29 3300025924 Ga0207694_10000153 Ga0207694_100001534 213
30 3300026035 Ga0207703_10000031 Ga0207703_1000003179 213
31 3300026116 Ga0207674_10001152 Ga0207674_100011522 213
32 3300026142 Ga0207698_10017011 Ga0207698_100170112 213
33 3300053136 Ga0500559_0072923 Ga0500559_0072923_770_1426 213
34 3300053139 Ga0500568_0001255 Ga0500568_0001255_10905_11609 213
35 iso_pu_bacteria 2862993130 2862995811 213
36 iso_pu_bacteria 2966924647 2966925056 213
37 iso_pu_bacteria 2643221542 2643733467 214
38 iso_pu_bacteria 2643221630 2644170041 214
39 iso_pu_bacteria 2852663356 2852665461 214
40 iso_pu_bacteria 2919395869 2919399312 214
41 iso_pu_bacteria 2919443155 2919445933 214
42 iso_pu_bacteria 8004182704 8004184968 214
43 3300044693 Ga0466961_0040307 Ga0466961_0040307_589_1278 215
44 3300044719 Ga0466971_0008680 Ga0466971_0008680_2541_3230 215
45 3300044901 Ga0466960_0015121 Ga0466960_0015121_1429_2118 215
46 3300045049 Ga0466959_0011675 Ga0466959_0011675_5236_5925 215
47 iso_pu_bacteria 2939660829 2939663976 215
48 3300005539 Ga0068853_100003819 Ga0068853_1000038197 216
49 3300005614 Ga0068856_100053474 Ga0068856_1000534742 216
50 3300005616 Ga0068852_100322546 Ga0068852_1003225462 216
51 3300025909 Ga0207705_10023358 Ga0207705_100233581 216
52 3300025919 Ga0207657_10095534 Ga0207657_100955343 216
53 3300025932 Ga0207690_10007620 Ga0207690_100076205 216
54 3300025949 Ga0207667_10078646 Ga0207667_100786462 216
55 3300026041 Ga0207639_10023630 Ga0207639_100236303 216
56 3300026078 Ga0207702_10100691 Ga0207702_101006912 216
57 3300026142 Ga0207698_10499615 Ga0207698_104996152 216
58 3300046471 Ga0495650_0000865 Ga0495650_0000865_6437_7102 216
59 iso_pu_bacteria 2585428157 2588108550 216
60 iso_pu_bacteria 2643221616 2644095916 216
61 iso_pu_bacteria 2857737099 2857739520 216
62 iso_pu_bacteria 2977251589 2977253840 216
63 3300049569 Ga0501032_0075200 Ga0501032_0075200_1490_2185 217
64 3300049571 Ga0501034_0038459 Ga0501034_0038459_1674_2369 217
65 3300049589 Ga0501073_0230394 Ga0501073_0230394_564_1259 217
66 iso_pu_bacteria 2643221575 2643885366 217
67 iso_pu_bacteria 2643221597 2643995682 217
68 iso_pu_bacteria 2808606306 2808631141 217
69 iso_pu_bacteria 2808606368 2808885691 217
70 iso_pu_bacteria 2808606447 2809227484 217
71 iso_pu_bacteria 2811994872 2812323171 217
72 iso_pu_bacteria 2821268502 2821270059 217
73 iso_pu_bacteria 2833709550 2833711012 217
74 iso_pu_bacteria 2852632344 2852634245 217
75 iso_pu_bacteria 2852646457 2852648595 217
76 iso_pu_bacteria 2857720070 2857720248 217
77 iso_pu_bacteria 2870628048 2870630414 217
78 iso_pu_bacteria 2928090899 2928091914 217
79 iso_pu_bacteria 2945968032 2945972041 217
80 iso_pu_bacteria 2984580707 2984581320 217
81 iso_pu_bacteria 8056037122 8056038882 217
82 iso_pu_bacteria 8057345674 8057349570 217
83 3300005331 Ga0070670_100192444 Ga0070670_1001924442 218
84 3300005355 Ga0070671_100194275 Ga0070671_1001942752 218
85 3300025925 Ga0207650_10245461 Ga0207650_102454612 218
86 3300046523 Ga0495644_0043339 Ga0495644_0043339_984_1661 218
87 3300046615 Ga0495656_0178540 Ga0495656_0178540_148_825 218
88 3300047472 Ga0495686_0012437 Ga0495686_0012437_4448_5149 218
89 iso_pu_bacteria 2643221635 2644198492 218
90 3300013105 Ga0157369_10170547 Ga0157369_101705473 219
91 3300053140 Ga0500573_0217472 Ga0500573_0217472_168_842 219
92 3300048920 Ga0496117_0000084 Ga0496117_0000084_24106_24783 220
93 3300048920 Ga0496117_0251088 Ga0496117_0251088_117_794 220
94 iso_pu_bacteria 2721755702 2723642375 220
95 iso_pu_bacteria 2808606372 2808902359 220
96 iso_pu_bacteria 2844841374 2844842323 220
97 iso_pu_bacteria 2919055335 2919057971 220
98 iso_pu_bacteria 2919523602 2919524364 220
99 iso_pu_bacteria 2928153084 2928156019 220
100 iso_pu_bacteria 2935409751 2935412756 220
101 iso_pu_bacteria 8055037949 8055038138 220
102 3300025929 Ga0207664_10261407 Ga0207664_102614072 221
103 3300044683 Ga0466965_0000002 Ga0466965_0000002_166260_166958 221
104 3300048925 Ga0496122_0005083 Ga0496122_0005083_3704_4384 221
105 3300048926 Ga0496123_0024015 Ga0496123_0024015_3902_4582 221
106 3300048927 Ga0496124_0097008 Ga0496124_0097008_99_779 221
107 3300049570 Ga0501033_0020565 Ga0501033_0020565_2637_3326 221
108 3300049571 Ga0501034_0202315 Ga0501034_0202315_737_1426 221
109 3300049572 Ga0501036_0254134 Ga0501036_0254134_238_927 221
110 3300049574 Ga0501038_0120657 Ga0501038_0120657_352_1041 221
111 3300049575 Ga0501039_0056050 Ga0501039_0056050_1585_2274 221
112 3300049584 Ga0501068_0055894 Ga0501068_0055894_379_1068 221
113 3300049586 Ga0501070_0000835 Ga0501070_0000835_17319_18008 221
114 3300049586 Ga0501070_0036132 Ga0501070_0036132_687_1376 221
115 3300053153 Ga0500616_0000071 Ga0500616_0000071_81820_82500 221
116 iso_pu_bacteria 2643221649 2644279283 221
117 iso_pu_bacteria 2974324384 2974326527 221
118 3300002067 JGI24735J21928_10000841 JGI24735J21928_1000084110 224
119 3300003578 Ga0006562J51391_1006772 Ga0006562J51391_10067721 224
120 3300048920 Ga0496117_0005139 Ga0496117_0005139_10827_11516 224
121 3300053140 Ga0500573_0000106 Ga0500573_0000106_1057_1782 224
122 3300053140 Ga0500573_0087746 Ga0500573_0087746_763_1452 224
123 3300053142 Ga0500577_0017365 Ga0500577_0017365_1165_1899 224
124 iso_pu_bacteria 2585428094 2587862543 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

20

147

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c02-assembly1.cif.gz_A x-ray structure of the aquaglyceroporin from plasmodium falciparum 0.3313 19 164
5j7y-assembly1.cif.gz_BC architecture of loose respirasome 0.312 15 163
1fx8-assembly1.cif.gz_A crystal structure of the e. coli glycerol facilitator (glpf) with substrate glycerol 0.3052 20 164
3klz-assembly1.cif.gz_A pentameric formate channel with formate bound 0.2987 2 192
8bxg-assembly1.cif.gz_B structure of the k/h exchanger kefc. 0.287 23 197
ID Description Score Start End Superfamily
2wzkA02 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.3628 29 153 1.20.1310.10
af_O17831_18_319_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3417 54 167 1.20.1070.10
af_Q9URV2_1077_1221_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3394 16 163 1.25.10.10
2wzkA02 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.3332 29 153 1.20.1310.10
af_Q0DAV8_7_650_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3239 20 224 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A3B8MQN2-F1-model_v4 DedA family protein 0.8982 1 165 GO:0005886
AF-A0A3B8MQN2-F1-model_v4 DedA family protein 0.8882 1 165 GO:0005886
AF-A0A520ERQ4-F1-model_v4 DedA family protein 0.8763 13 162 GO:0005886
AF-A0A4Q5TT03-F1-model_v4 DedA family protein 0.8608 2 163 GO:0005886
AF-M3HDG6-F1-model_v4 SNARE-like domain protein 0.8321 4 168 GO:0005886

Feature Viewer

pLDDT pTM Quality
75.09 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map