F124221

General Info

Members Datasets Scaffolds Average Seq Length
124 101 248 409

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_82613_c1|nmdc:mga00v17_82613_c1_78_1349
Length 397
Sequence MSTTRTAARKTVAKTALPTRTGVELDTFVWEGTDKRGVKMKGEQQSKNVNMLRAELRRQGIQPGVIKSKPKPLFGAAGKKISAKDIAVFSRQFATMIKSGVPVVQALEIVGNGNKNPRMAKMLNTMRLDIEGGSSINEALAKHPVQFDELFQNLVRAGESAGVLETVLDTIATYKENTEKLKGKIKKALFYPIAVIAVAIIVSAILLIFVVPQFESVFADFGAELPAFTQLIVSASRFMVEWALAGSIAGFLFAYKRSVPMQHAIDRMLLKIPVIGNLLHNAAIARFSRTLATTFKAGVPLVEALETVAGATGSSVYEKAVLRMRDDVSVGYQVNMAMKQVNLFPHMVVQMTAIGEEAGALDTMLFKVAEFYEEEVNNAVDALSSLLEPIFKLASVV

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
11 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
12 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
13 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
14 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
22 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
32 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
35 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
42 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
43 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
44 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
47 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
48 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
49 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
50 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
51 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
52 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
53 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
54 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
55 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
56 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
57 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
58 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
59 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
60 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
61 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
62 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
63 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
74 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
75 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
76 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
77 2643221559 Lysobacter sp. Root559 Isolate Unclassified
78 2643221573 Lysobacter sp. Root604 Isolate Unclassified
79 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
80 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
81 2643221586 Lysobacter sp. Root667 Isolate Unclassified
82 2643221612 Lysobacter sp. Root76 Isolate Unclassified
83 2643221695 Lysobacter sp. Root494 Isolate Unclassified
84 2643221720 Lysobacter sp. Root916 Isolate Unclassified
85 2643221727 Lysobacter sp. Root96 Isolate Unclassified
86 2643221728 Lysobacter sp. Root983 Isolate Unclassified
87 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
88 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
89 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
90 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
91 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
92 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
93 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
94 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
95 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
96 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
97 2919513703 Luteimonas sp. 3794 Isolate Unclassified
98 2919675420 Luteimonas terrae 4099 Isolate Unclassified
99 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
100 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
101 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.61
Metatranscriptomes 0
Isolates 23.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.74
Nodule 0
Rhizoplane 3.23
Rhizosphere 59.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_82613_c1 3300050491 Bacteria 2008
2 JGI25159J45721_1016761 3300002987 Bacteria 1548
3 Ga0055530_10001179 3300003791 Bacteria 20196
4 Ga0055531_10005089 3300003794 Bacteria 7776
5 Ga0055531_10006894 3300003794 Bacteria 6332
6 Ga0068869_100051863 3300005334 Bacteria 2977
7 Ga0068868_100202286 3300005338 Bacteria 1656
8 Ga0070671_100052898 3300005355 Bacteria 3376
9 Ga0070671_100152363 3300005355 Bacteria 1952
10 Ga0070693_100006224 3300005547 Bacteria 5784
11 Ga0075364_10161920 3300006051 Bacteria 1510
12 Ga0105248_10037269 3300009177 Bacteria 5440
13 Ga0105249_10109291 3300009553 Bacteria 2611
14 Ga0157371_10059542 3300013102 Bacteria 2707
15 Ga0157374_10004219 3300013296 Bacteria 12082
16 Ga0163162_10000657 3300013306 Bacteria 31982
17 Ga0157375_10001944 3300013308 Bacteria 17810
18 Ga0157376_10015933 3300014969 Bacteria 5694
19 Ga0182006_1001253 3300015261 Bacteria 15722
20 Ga0182006_1033540 3300015261 Bacteria 2057
21 Ga0182007_10000509 3300015262 Bacteria 22948
22 Ga0209130_1005786 3300025284 Bacteria 4182
23 Ga0209676_1000338 3300025292 Bacteria 89337
24 Ga0209676_1004533 3300025292 Bacteria 7698
25 Ga0209025_1002957 3300025294 Bacteria 16891
26 Ga0209025_1060393 3300025294 Bacteria 1424
27 Ga0209050_1000372 3300025298 Bacteria 85772
28 Ga0209050_1028179 3300025298 Bacteria 1829
29 Ga0209256_1001232 3300025299 Bacteria 28415
30 Ga0209257_1000383 3300025304 Bacteria 88315
31 Ga0209257_1002886 3300025304 Bacteria 15977
32 Ga0209257_1003346 3300025304 Bacteria 13870
33 Ga0209257_1005229 3300025304 Bacteria 9283
34 Ga0207644_10002606 3300025931 Bacteria 11609
35 Ga0207644_10021481 3300025931 Bacteria 4398
36 Ga0207704_10123843 3300025938 Bacteria 1775
37 Ga0207711_10009569 3300025941 Bacteria 8079
38 Ga0207641_10164639 3300026088 Bacteria 2019
39 Ga0207675_100271686 3300026118 Bacteria 1645
40 Ga0207683_10043232 3300026121 Bacteria 3937
41 Ga0265327_10000580 3300031251 Bacteria 61843
42 Ga0265327_10003058 3300031251 Bacteria 16533
43 Ga0265316_10000234 3300031344 Bacteria 64079
44 Ga0316576_10015715 3300031727 Bacteria 5088
45 Ga0316576_10075838 3300031727 Bacteria 2487
46 Ga0316578_10002070 3300031728 Bacteria 8577
47 Ga0316578_10016458 3300031728 Bacteria 4004
48 Ga0307516_10000688 3300031730 Bacteria 45895
49 Ga0316577_10107825 3300031733 Bacteria 1562
50 Ga0307414_10076947 3300032004 Bacteria 2426
51 Ga0316574_0043531 3300035398 Bacteria 2774
52 Ga0316584_0026331 3300036712 Bacteria 4275
53 Ga0316584_0066726 3300036712 Bacteria 2696
54 Ga0395905_0071678 3300037471 Bacteria 3248
55 Ga0439439_0001131 3300041406 Bacteria 5115
56 Ga0439465_0012093 3300041413 Bacteria 2703
57 Ga0439432_004651 3300042006 Bacteria 4998
58 Ga0439449_0021177 3300042007 Bacteria 2435
59 Ga0466967_0199005 3300045976 Bacteria 1897
60 Ga0495638_0049504 3300046460 Bacteria 2627
61 Ga0495638_0057403 3300046460 Bacteria 2414
62 Ga0495607_0109219 3300046501 Bacteria 1469
63 Ga0495606_0050417 3300046507 Bacteria 2723
64 Ga0495598_0002561 3300046537 Bacteria 3761
65 Ga0495656_0034187 3300046615 Bacteria 2080
66 Ga0495668_0065310 3300046616 Bacteria 2003
67 Ga0495625_0089836 3300046660 Bacteria 2126
68 Ga0495636_0000285 3300047318 Bacteria 19724
69 Ga0495677_0019485 3300047445 Bacteria 2460
70 Ga0495686_0026613 3300047472 Bacteria 3783
71 Ga0495686_0085494 3300047472 Bacteria 1921
72 Ga0496103_0071208 3300048906 Bacteria 2176
73 Ga0496110_0242020 3300048913 Bacteria 1642
74 Ga0496111_0046239 3300048914 Bacteria 3133
75 Ga0496112_0333519 3300048915 Bacteria 1460
76 Ga0496116_0025499 3300048919 Bacteria 4345
77 Ga0496116_0109881 3300048919 Bacteria 1623
78 Ga0496120_0014094 3300048923 Bacteria 5341
79 Ga0496121_0153463 3300048924 Bacteria 1692
80 Ga0496124_0062835 3300048927 Bacteria 3105
81 Ga0496125_0023156 3300048928 Bacteria 5742
82 Ga0496125_0082844 3300048928 Bacteria 2443
83 Ga0496126_0005370 3300048929 Bacteria 14638
84 Ga0501031_0040539 3300049568 Bacteria 3041
85 Ga0501031_0057759 3300049568 Bacteria 2528
86 Ga0501033_0001322 3300049570 Bacteria 22031
87 Ga0501034_0002883 3300049571 Bacteria 19992
88 Ga0501039_0035309 3300049575 Bacteria 3858
89 Ga0501043_0007397 3300049579 Bacteria 8710
90 Ga0501035_0150432 3300049822 Bacteria 2020
91 Ga0501044_0160110 3300049823 Bacteria 2228
92 nmdc:mga00v17_10180_c2 3300050491 Bacteria 2633
93 nmdc:mga00v17_124091_c1 3300050491 Bacteria 1647
94 nmdc:mga00v17_13183_c1 3300050491 Bacteria 4581
95 nmdc:mga00v17_178087_c1 3300050491 Bacteria 1372
96 2525558128 2524614729 Bacteria 3091755
97 2572254789 2571042365 Bacteria 3289345
98 2578457239 2576861471 Bacteria 4648976
99 2630649931 2627854209 Bacteria 3093011
100 2643818333 2643221559 Bacteria 4424915
101 2643880813 2643221573 Bacteria 4784121
102 2643905346 2643221579 Bacteria 4443405
103 2643915026 2643221581 Bacteria 3893603
104 2643938525 2643221586 Bacteria 4446529
105 2644079177 2643221612 Bacteria 4361984
106 2644530523 2643221695 Bacteria 3441323
107 2644661382 2643221720 Bacteria 4694283
108 2644693954 2643221727 Bacteria 4415595
109 2644699462 2643221728 Bacteria 4797149
110 2748016775 2747842501 Bacteria 5293829
111 2842759204 2842757796 Bacteria 3981385
112 2852652362 2852649853 Bacteria 4036942
113 2852686833 2852684882 Bacteria 5463342
114 2857445194 2857442823 Bacteria 4562550
115 2894417878 2894414249 Bacteria 4405451
116 2895499467 2895498888 Bacteria 5283788
117 2895512489 2895511927 Bacteria 6802080
118 2895522500 2895522137 Bacteria 3284416
119 2895525734 2895525241 Bacteria 3388457
120 2919514981 2919513703 Bacteria 3844312
121 2919676396 2919675420 Bacteria 3969095
122 2939589569 2939589442 Bacteria 4214238
123 2939626065 2939622612 Bacteria 4698046
124 8003015196 8003014200 Bacteria 4059994
125 nmdc:mga00v17_82613_c1
126 JGI25159J45721_1016761
127 Ga0055530_10001179
128 Ga0055531_10005089
129 Ga0055531_10006894
130 Ga0068869_100051863
131 Ga0068868_100202286
132 Ga0070671_100052898
133 Ga0070671_100152363
134 Ga0070693_100006224
135 Ga0075364_10161920
136 Ga0105248_10037269
137 Ga0105249_10109291
138 Ga0157371_10059542
139 Ga0157374_10004219
140 Ga0163162_10000657
141 Ga0157375_10001944
142 Ga0157376_10015933
143 Ga0182006_1001253
144 Ga0182006_1033540
145 Ga0182007_10000509
146 Ga0209130_1005786
147 Ga0209676_1000338
148 Ga0209676_1004533
149 Ga0209025_1002957
150 Ga0209025_1060393
151 Ga0209050_1000372
152 Ga0209050_1028179
153 Ga0209256_1001232
154 Ga0209257_1000383
155 Ga0209257_1002886
156 Ga0209257_1003346
157 Ga0209257_1005229
158 Ga0207644_10002606
159 Ga0207644_10021481
160 Ga0207704_10123843
161 Ga0207711_10009569
162 Ga0207641_10164639
163 Ga0207675_100271686
164 Ga0207683_10043232
165 Ga0265327_10000580
166 Ga0265327_10003058
167 Ga0265316_10000234
168 Ga0316576_10015715
169 Ga0316576_10075838
170 Ga0316578_10002070
171 Ga0316578_10016458
172 Ga0307516_10000688
173 Ga0316577_10107825
174 Ga0307414_10076947
175 Ga0316574_0043531
176 Ga0316584_0026331
177 Ga0316584_0066726
178 Ga0395905_0071678
179 Ga0439439_0001131
180 Ga0439465_0012093
181 Ga0439432_004651
182 Ga0439449_0021177
183 Ga0466967_0199005
184 Ga0495638_0049504
185 Ga0495638_0057403
186 Ga0495607_0109219
187 Ga0495606_0050417
188 Ga0495598_0002561
189 Ga0495656_0034187
190 Ga0495668_0065310
191 Ga0495625_0089836
192 Ga0495636_0000285
193 Ga0495677_0019485
194 Ga0495686_0026613
195 Ga0495686_0085494
196 Ga0496103_0071208
197 Ga0496110_0242020
198 Ga0496111_0046239
199 Ga0496112_0333519
200 Ga0496116_0025499
201 Ga0496116_0109881
202 Ga0496120_0014094
203 Ga0496121_0153463
204 Ga0496124_0062835
205 Ga0496125_0023156
206 Ga0496125_0082844
207 Ga0496126_0005370
208 Ga0501031_0040539
209 Ga0501031_0057759
210 Ga0501033_0001322
211 Ga0501034_0002883
212 Ga0501039_0035309
213 Ga0501043_0007397
214 Ga0501035_0150432
215 Ga0501044_0160110
216 nmdc:mga00v17_10180_c2
217 nmdc:mga00v17_124091_c1
218 nmdc:mga00v17_13183_c1
219 nmdc:mga00v17_178087_c1
220 2525558128
221 2572254789
222 2578457239
223 2630649931
224 2643818333
225 2643880813
226 2643905346
227 2643915026
228 2643938525
229 2644079177
230 2644530523
231 2644661382
232 2644693954
233 2644699462
234 2748016775
235 2842759204
236 2852652362
237 2852686833
238 2857445194
239 2894417878
240 2895499467
241 2895512489
242 2895522500
243 2895525734
244 2919514981
245 2919676396
246 2939589569
247 2939626065
248 8003015196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

89

212

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

287

396

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9622 74 176
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9621 76 181
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9602 75 183
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9503 74 181
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9449 76 181
ID Description Score Start End Superfamily
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9622 74 176 1.20.81.30
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.95 284 384 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9453 273 380 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9443 74 176 1.20.81.30
af_P36646_1_51_3.10.20.10 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.941 21 65 3.10.20.10
ID Description Score Start End GO Terms
AF-A0A7V4HFC1-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9743 78 171 GO:0005886
AF-A0A7Z9PV31-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9691 76 171 GO:0005886
AF-R9IRW6-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9622 272 396 GO:0005886
GO:0015628
AF-A0A1F4CLS2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9465 91 405 GO:0005886
GO:0015628
AF-A0A1F5AC00-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9435 138 409 GO:0005886
GO:0015628

Map