F125397

General Info

Members Datasets Scaffolds Average Seq Length
125 98 250 676

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100074108|Ga0070671_1000741082
Length 741
Sequence MLSQIMRRDRGSSSGSRRLRQPFYPFSNVSGGTSSTLPTQVLKTSGFKSGKPISRQGVGYTVAMELQSPVTAVKGVGEELAKKLAVLGVKTVADLIDYLPRRYEDYSDVVAIRDTQPGPVTVKAVVKQATGRYVRRGMHITEAVASDETGSIRLIWFNQPYRANGLKVGLEYYFSGLFELSHQRMQMTSPSAELVSDFTVNTARIVPVYRETKGLTSKQIRKVVGNCRNLTRTLPXXXXKWLVQEQQLMSRSEAVLAMHFPADGAQLAEARRRLGFEEVFELSLAALMNKLELAADDSLVIPFDEQLAKDFVGHLPFKLTDAQRKAVWRIYQDMQAERPMNRLVEGDVGSGKTVVATMAALMALRQGYQAALMAPTEILARQHAETIYKLLQPLGMEAELTLLVGALTGAQKKKAQEAIAAGEARFVVGTQALIQDAVDMHKLGLVIIDEQHRFGVEQRRELMKKAGHMPHLLSLTATPIPRSLALTLYGELDISVLDQKPAGRQPIRTEIVSPNSVEPVYNDIRKDLDDGRQMFVVCPLISESGSVDAHSAEKIYEQYRKKEFKNYRLGLLHGKMKAEEKAAVMQQFVAHELDILVSTTVIEVGVDVPNASVMMIQSAERFGLAQLHQLRGRVGRGGHKAYCYLMMSDSTAPSRRLRALESSQDGFKLAELDLELRGPGAIYGQMQHGALDLRVARLTDVKLIAEARSAAAEFLERGENLVQYTELSARVTRLRTVTNLN

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
77 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
78 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
79 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
83 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
84 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
85 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
86 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
87 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
88 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
89 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
90 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
91 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
92 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
93 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
94 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
95 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
96 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
97 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
98 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.2
Nodule 0
Rhizoplane 0.8
Rhizosphere 71.2
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100074108 3300005355 Bacteria 2844
2 JGI24737J22298_10000026 3300001990 Bacteria 43680
3 JGI24735J21928_10000080 3300002067 Bacteria 37384
4 JGI24742J22300_10000395 3300002244 Bacteria 6490
5 rootH2_10000244 3300003320 Bacteria 697651
6 Ga0070658_10000012 3300005327 Bacteria 277871
7 Ga0070658_10002757 3300005327 Bacteria 14623
8 Ga0070676_10015889 3300005328 Bacteria 4153
9 Ga0070683_100000138 3300005329 Bacteria 47210
10 Ga0070683_100000261 3300005329 Bacteria 36323
11 Ga0070680_100024487 3300005336 Bacteria 4823
12 Ga0070682_100008335 3300005337 Bacteria 5843
13 Ga0070671_100003481 3300005355 Bacteria 12283
14 Ga0070674_100005957 3300005356 Bacteria 7087
15 Ga0070673_100000224 3300005364 Bacteria 28378
16 Ga0070667_100023554 3300005367 Bacteria 5110
17 Ga0070678_100009843 3300005456 Bacteria 5812
18 Ga0070681_10010536 3300005458 Bacteria 9128
19 Ga0068867_100009996 3300005459 Bacteria 6687
20 Ga0070685_10000215 3300005466 Bacteria 38049
21 Ga0070685_10001953 3300005466 Bacteria 10699
22 Ga0070679_100001025 3300005530 Bacteria 24372
23 Ga0070679_100002235 3300005530 Bacteria 17482
24 Ga0070684_100000229 3300005535 Bacteria 38887
25 Ga0070684_100006296 3300005535 Bacteria 9170
26 Ga0068856_100004358 3300005614 Bacteria 14102
27 Ga0068856_100007844 3300005614 Bacteria 10425
28 Ga0068863_100021190 3300005841 Bacteria 6205
29 Ga0081455_10000003 3300005937 Bacteria 367763
30 Ga0075365_10000043 3300006038 Bacteria 41148
31 Ga0075365_10021744 3300006038 Bacteria 4007
32 Ga0075364_10006212 3300006051 Bacteria 7007
33 Ga0075367_10000088 3300006178 Bacteria 24938
34 Ga0075369_10000005 3300006186 Bacteria 147699
35 Ga0075366_10000294 3300006195 Bacteria 22461
36 Ga0075366_10000347 3300006195 Bacteria 21166
37 Ga0075366_10000501 3300006195 Bacteria 18164
38 Ga0068865_100061371 3300006881 Bacteria 2635
39 Ga0105240_10000003 3300009093 Bacteria 1183681
40 Ga0111539_10039892 3300009094 Bacteria 5655
41 Ga0105245_10000001 3300009098 Bacteria 939270
42 Ga0105243_10000001 3300009148 Bacteria 1156578
43 Ga0105242_10000135 3300009176 Bacteria 53544
44 Ga0105248_10073046 3300009177 Bacteria 3855
45 Ga0105237_10016883 3300009545 Bacteria 7575
46 Ga0105249_10000802 3300009553 Bacteria 28271
47 Ga0105239_10077883 3300010375 Bacteria 3648
48 Ga0157373_10000042 3300013100 Bacteria 113564
49 Ga0157374_10000195 3300013296 Bacteria 56142
50 Ga0157374_10006505 3300013296 Bacteria 9922
51 Ga0157377_10002876 3300014745 Bacteria 7692
52 Ga0157376_10000001 3300014969 Bacteria 842910
53 Ga0207645_10001659 3300025907 Bacteria 18129
54 Ga0207705_10000056 3300025909 Bacteria 157554
55 Ga0207707_10002145 3300025912 Bacteria 17855
56 Ga0207707_10049305 3300025912 Bacteria 3668
57 Ga0207695_10000005 3300025913 Bacteria 1196715
58 Ga0207652_10002984 3300025921 Bacteria 14137
59 Ga0207652_10023052 3300025921 Bacteria 5156
60 Ga0207694_10049620 3300025924 Bacteria 3249
61 Ga0207687_10000030 3300025927 Bacteria 155548
62 Ga0207687_10014067 3300025927 Bacteria 5232
63 Ga0207644_10058854 3300025931 Bacteria 2778
64 Ga0207686_10000001 3300025934 Bacteria 1169580
65 Ga0207709_10000002 3300025935 Bacteria 1171536
66 Ga0207704_10027912 3300025938 Bacteria 3123
67 Ga0207661_10000021 3300025944 Bacteria 205381
68 Ga0207661_10001940 3300025944 Bacteria 14232
69 Ga0207651_10000167 3300025960 Bacteria 28415
70 Ga0207702_10000001 3300026078 Bacteria 895738
71 Ga0207702_10006082 3300026078 Bacteria 10466
72 Ga0207702_10006432 3300026078 Bacteria 10135
73 Ga0207641_10054799 3300026088 Bacteria 3385
74 Ga0207648_10058915 3300026089 Bacteria 3349
75 Ga0207674_10075975 3300026116 Bacteria 3368
76 Ga0207683_10046114 3300026121 Bacteria 3813
77 Ga0207428_10035830 3300027907 Bacteria 4052
78 Ga0268266_10010164 3300028379 Bacteria 8246
79 Ga0265334_10000184 3300028573 Bacteria 36597
80 Ga0265338_10000192 3300028800 Bacteria 115195
81 Ga0265338_10000601 3300028800 Bacteria 63282
82 Ga0265340_10001568 3300031247 Bacteria 13122
83 Ga0265327_10000017 3300031251 Bacteria 445264
84 Ga0395900_0001560 3300037418 Bacteria 27209
85 Ga0395900_0048333 3300037418 Unclassified 4382
86 Ga0395898_0024777 3300037466 Bacteria 6049
87 Ga0395905_0000238 3300037471 Bacteria 83164
88 Ga0395905_0003963 3300037471 Bacteria 15579
89 Ga0395901_0035170 3300038443 Bacteria 5177
90 Ga0395901_0053393 3300038443 Bacteria 4199
91 Ga0495649_0000073 3300046694 Bacteria 86337
92 Ga0496112_0020640 3300048915 Bacteria 6247
93 Ga0501034_0005296 3300049571 Bacteria 14147
94 Ga0501034_0014737 3300049571 Bacteria 8047
95 Ga0501036_0062688 3300049572 Bacteria 3149
96 Ga0501047_0000229 3300049581 Bacteria 66412
97 Ga0501070_0051598 3300049586 Bacteria 3414
98 Ga0501035_0000033 3300049822 Bacteria 175087
99 nmdc:mga00v17_11970_c1 3300050491 Bacteria 4775
100 nmdc:mga0yw44_25531_c1 3300050492 Bacteria 3361
101 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
102 nmdc:mga0k408_2058_c1 3300050493 Bacteria 10755
103 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
104 nmdc:mga0k408_6766_c1 3300050493 Bacteria 6114
105 nmdc:mga06z11_44_c1 3300050494 Bacteria 47967
106 nmdc:mga08y16_56379_c1 3300050511 Bacteria 4107
107 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
108 Ga0500610_0007632 3300053079 Bacteria 4647
109 Ga0500643_000011 3300053087 Bacteria 385630
110 Ga0500644_0000626 3300053088 Bacteria 13206
111 Ga0500644_0002138 3300053088 Bacteria 5002
112 Ga0500646_0000261 3300053090 Bacteria 16106
113 Ga0500583_0000052 3300053092 Bacteria 75622
114 Ga0500651_0000240 3300053093 Bacteria 33761
115 Ga0500651_0000452 3300053093 Bacteria 21958
116 Ga0500650_0000001 3300053098 Bacteria 818797
117 Ga0500556_0000295 3300053104 Bacteria 38375
118 Ga0500562_000002 3300053108 Bacteria 977234
119 Ga0500594_0000001 3300053118 Bacteria 1178472
120 Ga0500561_0000001 3300053137 Bacteria 957685
121 Ga0500577_0001896 3300053142 Bacteria 5358
122 Ga0500579_001549 3300053143 Bacteria 13507
123 Ga0500589_000016 3300053147 Bacteria 107090
124 Ga0500633_0000659 3300053160 Bacteria 5767
125 Ga0500570_000005 3300053724 Bacteria 132994
126 Ga0070671_100074108
127 JGI24737J22298_10000026
128 JGI24735J21928_10000080
129 JGI24742J22300_10000395
130 rootH2_10000244
131 Ga0070658_10000012
132 Ga0070658_10002757
133 Ga0070676_10015889
134 Ga0070683_100000138
135 Ga0070683_100000261
136 Ga0070680_100024487
137 Ga0070682_100008335
138 Ga0070671_100003481
139 Ga0070674_100005957
140 Ga0070673_100000224
141 Ga0070667_100023554
142 Ga0070678_100009843
143 Ga0070681_10010536
144 Ga0068867_100009996
145 Ga0070685_10000215
146 Ga0070685_10001953
147 Ga0070679_100001025
148 Ga0070679_100002235
149 Ga0070684_100000229
150 Ga0070684_100006296
151 Ga0068856_100004358
152 Ga0068856_100007844
153 Ga0068863_100021190
154 Ga0081455_10000003
155 Ga0075365_10000043
156 Ga0075365_10021744
157 Ga0075364_10006212
158 Ga0075367_10000088
159 Ga0075369_10000005
160 Ga0075366_10000294
161 Ga0075366_10000347
162 Ga0075366_10000501
163 Ga0068865_100061371
164 Ga0105240_10000003
165 Ga0111539_10039892
166 Ga0105245_10000001
167 Ga0105243_10000001
168 Ga0105242_10000135
169 Ga0105248_10073046
170 Ga0105237_10016883
171 Ga0105249_10000802
172 Ga0105239_10077883
173 Ga0157373_10000042
174 Ga0157374_10000195
175 Ga0157374_10006505
176 Ga0157377_10002876
177 Ga0157376_10000001
178 Ga0207645_10001659
179 Ga0207705_10000056
180 Ga0207707_10002145
181 Ga0207707_10049305
182 Ga0207695_10000005
183 Ga0207652_10002984
184 Ga0207652_10023052
185 Ga0207694_10049620
186 Ga0207687_10000030
187 Ga0207687_10014067
188 Ga0207644_10058854
189 Ga0207686_10000001
190 Ga0207709_10000002
191 Ga0207704_10027912
192 Ga0207661_10000021
193 Ga0207661_10001940
194 Ga0207651_10000167
195 Ga0207702_10000001
196 Ga0207702_10006082
197 Ga0207702_10006432
198 Ga0207641_10054799
199 Ga0207648_10058915
200 Ga0207674_10075975
201 Ga0207683_10046114
202 Ga0207428_10035830
203 Ga0268266_10010164
204 Ga0265334_10000184
205 Ga0265338_10000192
206 Ga0265338_10000601
207 Ga0265340_10001568
208 Ga0265327_10000017
209 Ga0395900_0001560
210 Ga0395900_0048333
211 Ga0395898_0024777
212 Ga0395905_0000238
213 Ga0395905_0003963
214 Ga0395901_0035170
215 Ga0395901_0053393
216 Ga0495649_0000073
217 Ga0496112_0020640
218 Ga0501034_0005296
219 Ga0501034_0014737
220 Ga0501036_0062688
221 Ga0501047_0000229
222 Ga0501070_0051598
223 Ga0501035_0000033
224 nmdc:mga00v17_11970_c1
225 nmdc:mga0yw44_25531_c1
226 nmdc:mga0yw44_2_c1
227 nmdc:mga0k408_2058_c1
228 nmdc:mga0k408_24_c2
229 nmdc:mga0k408_6766_c1
230 nmdc:mga06z11_44_c1
231 nmdc:mga08y16_56379_c1
232 nmdc:mga0sz30_1_c1
233 Ga0500610_0007632
234 Ga0500643_000011
235 Ga0500644_0000626
236 Ga0500644_0002138
237 Ga0500646_0000261
238 Ga0500583_0000052
239 Ga0500651_0000240
240 Ga0500651_0000452
241 Ga0500650_0000001
242 Ga0500556_0000295
243 Ga0500562_000002
244 Ga0500594_0000001
245 Ga0500561_0000001
246 Ga0500577_0001896
247 Ga0500579_001549
248 Ga0500589_000016
249 Ga0500633_0000659
250 Ga0500570_000005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17191

RecG_wedge

RecG wedge domain

69

231

0.91

PF00271

Helicase_C

Helicase conserved C-terminal domain

519

638

0.85

PF19833

RecG_dom3_C

ATP-dependent DNA helicase RecG, domain 3, C-terminal

663

741

0.84

PF00270

DEAD

DEAD/DEAH box helicase

320

487

0.81

PF04851

ResIII

Type III restriction enzyme, res subunit

316

481

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g2i-assembly1.cif.gz_B filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) at 5.9 a resolution 0.8416 61 94
6xeo-assembly1.cif.gz_A structure of mfd bound to dsdna 0.8128 205 661
6g2h-assembly1.cif.gz_E filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) core at 4.6 a resolution 0.8038 61 94
1ue7-assembly2.cif.gz_D-3 crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis 0.801 53 131
7ssg-assembly1.cif.gz_A mfd dna complex 0.7985 234 619
ID Description Score Start End Superfamily
af_A0A0P0VNY0_1_181_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9192 288 442 3.40.50.300
af_A0A1D6HHW2_464_714_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9186 244 434 3.40.50.300
1gm5A03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9119 44 130 2.40.50.140
af_O50581_207_441_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9072 200 436 3.40.50.300
af_O50581_207_441_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8999 200 436 3.40.50.300
ID Description Score Start End GO Terms
AF-W1YQ35-F1-model_v4 Transcription-repair coupling factor 0.9563 228 332 GO:0003677
GO:0003678
GO:0005524
GO:0006281
GO:0016787
AF-A0A536CBE8-F1-model_v4 DEAD/DEAH box helicase 0.949 235 396 GO:0003677
GO:0003678
GO:0005524
GO:0006281
GO:0016787
AF-A0A255SW64-F1-model_v4 deleted 0.9489 290 443
AF-G9J5X6-F1-model_v4 ATP-dependent DNA helicase 0.9396 308 550 GO:0003677
GO:0003678
GO:0005524
GO:0006281
GO:0016787
AF-A0A4U9D4B1-F1-model_v4 ATP-dependent DNA helicase recG (EC 3.6.4.12) 0.9363 264 417 GO:0003677
GO:0005524
GO:0006281
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518

Map