F130356

General Info

Members Datasets Scaffolds Average Seq Length
126 103 252 167

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10088870|Ga0105249_100888702
Length 190
Sequence VLSFFYLYASFPVIQRENTSQENNNKMKVLEATPKDIPLIQDLAKRSWEMAYSKILSPAQISYMMAEMYSEKEISSQMEDPNWRYFLIKDDEENFGGFIGYQFNYEPKTTKLHRIYMVPEAKGKGLGKFALNYLKNHVSDNDNERIILNVNKYNNAKDFYESQGFKVYEEGVFDIGNGYVMDDYLMEFFV

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
35 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
36 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
37 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
38 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
39 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
40 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
41 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
42 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
43 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
44 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
45 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
46 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
47 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
48 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
49 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
50 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
51 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
52 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
53 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
56 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
57 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
58 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
59 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
60 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
61 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
62 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
63 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
64 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
65 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
66 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
67 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
68 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
69 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
70 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
71 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
72 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
73 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
74 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
75 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
76 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
77 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
78 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
79 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
80 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
81 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
82 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
83 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
84 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
85 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
86 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
87 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
88 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
89 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
90 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
91 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
92 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
93 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
94 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
95 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
96 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
97 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
98 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
99 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
100 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
101 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
102 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
103 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.05
Metatranscriptomes 0
Isolates 30.95

Biome Distribution

Category Percentage (%)
Aerial Root 1.59
Bulb 0
Endosphere 1.59
Nodule 0.79
Rhizoplane 2.38
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10088870 3300009553 Bacteria 2886
2 JGI24741J21665_1001657 3300001915 Bacteria 6191
3 rootH2_10128703 3300003320 Bacteria 3197
4 rootL2_10322079 3300003322 Bacteria 3582
5 rootH1_10170067 3300003323 Bacteria 10545
6 Ga0065714_10064738 3300005288 Bacteria 20662
7 Ga0065704_10078547 3300005289 Bacteria 4397
8 Ga0070683_100002446 3300005329 Bacteria 14775
9 Ga0070682_100000414 3300005337 Bacteria 27812
10 Ga0070661_101290104 3300005344 Bacteria 612
11 Ga0070668_100660509 3300005347 Bacteria 919
12 Ga0070663_100098010 3300005455 Bacteria 2183
13 Ga0070684_100011515 3300005535 Bacteria 7045
14 Ga0105244_10000018 3300009036 Bacteria 244992
15 Ga0105250_10017223 3300009092 Bacteria 2937
16 Ga0105243_10000181 3300009148 Bacteria 73220
17 Ga0105243_10831766 3300009148 Bacteria 913
18 Ga0157373_10000056 3300013100 Bacteria 100327
19 Ga0157373_10198222 3300013100 Bacteria 1415
20 Ga0157370_10000940 3300013104 Bacteria 36954
21 Ga0157370_10108358 3300013104 Bacteria 2598
22 Ga0157370_10249093 3300013104 Bacteria 1643
23 Ga0157370_10268891 3300013104 Bacteria 1575
24 Ga0157375_10837791 3300013308 Bacteria 1067
25 Ga0182008_10000007 3300014497 Bacteria 372461
26 Ga0182006_1000137 3300015261 Bacteria 78702
27 Ga0163161_10005837 3300017792 Bacteria 8531
28 Ga0163161_10006678 3300017792 Bacteria 7983
29 Ga0163161_10234974 3300017792 Bacteria 1424
30 Ga0209675_1000051 3300025291 Bacteria 206342
31 Ga0209564_1043468 3300025295 Bacteria 1179
32 Ga0207696_1107340 3300025711 Bacteria 758
33 Ga0207655_1000058 3300025728 Bacteria 267656
34 Ga0207709_10001184 3300025935 Bacteria 18854
35 Ga0207661_10012290 3300025944 Bacteria 6219
36 Ga0207712_10122952 3300025961 Bacteria 1966
37 Ga0207668_10888734 3300025972 Bacteria 792
38 Ga0207678_10125688 3300026067 Bacteria 2188
39 Ga0307412_10000074 3300031911 Bacteria 99093
40 Ga0307412_10000568 3300031911 Bacteria 21902
41 Ga0307412_10000768 3300031911 Bacteria 18548
42 Ga0307412_10243732 3300031911 Bacteria 1392
43 Ga0307416_100000020 3300032002 Bacteria 192862
44 Ga0307414_10000004 3300032004 Bacteria 472218
45 Ga0307414_10036846 3300032004 Bacteria 3270
46 Ga0439465_0000078 3300041413 Bacteria 21186
47 Ga0439445_0000029 3300042004 Bacteria 19260
48 Ga0495627_000029 3300046453 Bacteria 232349
49 Ga0495627_065213 3300046453 Bacteria 1070
50 Ga0495638_0121689 3300046460 Bacteria 1541
51 Ga0495596_0000731 3300046500 Bacteria 20231
52 Ga0495606_0002564 3300046507 Bacteria 20867
53 Ga0495606_0011636 3300046507 Bacteria 7148
54 Ga0495610_0000001 3300046512 Bacteria 1620061
55 Ga0495632_0078217 3300046519 Bacteria 1580
56 Ga0495663_0000340 3300046525 Bacteria 17405
57 Ga0495663_0001217 3300046525 Bacteria 8271
58 Ga0495654_0000008 3300046530 Bacteria 398340
59 Ga0495609_0000010 3300046538 Bacteria 342605
60 Ga0495633_0000048 3300046558 Bacteria 158166
61 Ga0495633_0000126 3300046558 Bacteria 101794
62 Ga0495625_0000217 3300046660 Bacteria 90783
63 Ga0495686_0000684 3300047472 Bacteria 45904
64 Ga0495686_0004337 3300047472 Bacteria 11717
65 Ga0496102_0121516 3300048905 Bacteria 2439
66 Ga0496104_0532484 3300048907 Bacteria 1086
67 Ga0496114_0975921 3300048917 Bacteria 730
68 Ga0496116_0000037 3300048919 Bacteria 374675
69 Ga0496117_0000086 3300048920 Bacteria 212331
70 Ga0496118_0000333 3300048921 Bacteria 80356
71 Ga0496118_0141878 3300048921 Bacteria 1521
72 Ga0496119_0000037 3300048922 Bacteria 210912
73 Ga0496122_0000884 3300048925 Bacteria 55830
74 Ga0496122_0001021 3300048925 Bacteria 49512
75 Ga0496122_0001440 3300048925 Bacteria 38513
76 Ga0496123_0001544 3300048926 Bacteria 31765
77 Ga0496123_0005964 3300048926 Bacteria 11997
78 Ga0496123_0011815 3300048926 Bacteria 7518
79 Ga0496124_0000810 3300048927 Bacteria 50853
80 Ga0496125_0000300 3300048928 Bacteria 97275
81 Ga0496125_0033606 3300048928 Bacteria 4535
82 Ga0496125_0095302 3300048928 Bacteria 2214
83 Ga0496126_0000726 3300048929 Bacteria 59824
84 Ga0501303_001079 3300049526 Bacteria 2041
85 Ga0501251_001812 3300049681 Bacteria 2013
86 Ga0501241_000026 3300049758 Bacteria 59606
87 Ga0501269_000152 3300049766 Bacteria 21368
88 2511232760 2511231000 Bacteria 4488346
89 2585159534 2582581281 Bacteria 4487904
90 2585163790 2582581282 Bacteria 4495830
91 2585426462 2582581873 Bacteria 3032664
92 2587679038 2585428045 Bacteria 5203023
93 2587749025 2585428060 Bacteria 5304711
94 2587752172 2585428061 Bacteria 3939663
95 2587868245 2585428095 Bacteria 3789702
96 2587942379 2585428115 Bacteria 4420269
97 2588211660 2585428182 Bacteria 5007281
98 2588216686 2585428183 Bacteria 5166119
99 2588220763 2585428184 Bacteria 4978681
100 2588226041 2585428185 Bacteria 4969476
101 2588231157 2585428187 Bacteria 4629388
102 2588447958 2588253712 Bacteria 5403181
103 2590603487 2588254255 Bacteria 5014294
104 2590610622 2588254257 Bacteria 5436094
105 2729202362 2728369107 Bacteria 5082720
106 2738699905 2738541273 Bacteria 4048577
107 2739253654 2738543014 Bacteria 4048139
108 2740060821 2739367874 Bacteria 4872888
109 2753674857 2751185877 Bacteria 4921427
110 2765576105 2765235839 Bacteria 5314748
111 2772605971 2772190705 Bacteria 4666226
112 2775673972 2775506739 Bacteria 3855222
113 2816875783 2816332188 Bacteria 5133218
114 2842087383 2842083920 Bacteria 4857652
115 2871724461 2871720351 Bacteria 4862476
116 2889293397 2889290771 Bacteria 5530962
117 2906002421 2905999023 Bacteria 4591259
118 2919100070 2919097161 Bacteria 3860339
119 2919401422 2919399522 Bacteria 5164947
120 2945928527 2945924605 Bacteria 4296724
121 2946020016 2946019816 Bacteria 4621265
122 2977247340 2977243572 Bacteria 4374394
123 2984574816 2984572630 Bacteria 4186940
124 2984608269 2984606641 Bacteria 4186971
125 2993376367 2993372514 Bacteria 4214139
126 2993483162 2993480792 Bacteria 4022225
127 Ga0105249_10088870
128 JGI24741J21665_1001657
129 rootH2_10128703
130 rootL2_10322079
131 rootH1_10170067
132 Ga0065714_10064738
133 Ga0065704_10078547
134 Ga0070683_100002446
135 Ga0070682_100000414
136 Ga0070661_101290104
137 Ga0070668_100660509
138 Ga0070663_100098010
139 Ga0070684_100011515
140 Ga0105244_10000018
141 Ga0105250_10017223
142 Ga0105243_10000181
143 Ga0105243_10831766
144 Ga0157373_10000056
145 Ga0157373_10198222
146 Ga0157370_10000940
147 Ga0157370_10108358
148 Ga0157370_10249093
149 Ga0157370_10268891
150 Ga0157375_10837791
151 Ga0182008_10000007
152 Ga0182006_1000137
153 Ga0163161_10005837
154 Ga0163161_10006678
155 Ga0163161_10234974
156 Ga0209675_1000051
157 Ga0209564_1043468
158 Ga0207696_1107340
159 Ga0207655_1000058
160 Ga0207709_10001184
161 Ga0207661_10012290
162 Ga0207712_10122952
163 Ga0207668_10888734
164 Ga0207678_10125688
165 Ga0307412_10000074
166 Ga0307412_10000568
167 Ga0307412_10000768
168 Ga0307412_10243732
169 Ga0307416_100000020
170 Ga0307414_10000004
171 Ga0307414_10036846
172 Ga0439465_0000078
173 Ga0439445_0000029
174 Ga0495627_000029
175 Ga0495627_065213
176 Ga0495638_0121689
177 Ga0495596_0000731
178 Ga0495606_0002564
179 Ga0495606_0011636
180 Ga0495610_0000001
181 Ga0495632_0078217
182 Ga0495663_0000340
183 Ga0495663_0001217
184 Ga0495654_0000008
185 Ga0495609_0000010
186 Ga0495633_0000048
187 Ga0495633_0000126
188 Ga0495625_0000217
189 Ga0495686_0000684
190 Ga0495686_0004337
191 Ga0496102_0121516
192 Ga0496104_0532484
193 Ga0496114_0975921
194 Ga0496116_0000037
195 Ga0496117_0000086
196 Ga0496118_0000333
197 Ga0496118_0141878
198 Ga0496119_0000037
199 Ga0496122_0000884
200 Ga0496122_0001021
201 Ga0496122_0001440
202 Ga0496123_0001544
203 Ga0496123_0005964
204 Ga0496123_0011815
205 Ga0496124_0000810
206 Ga0496125_0000300
207 Ga0496125_0033606
208 Ga0496125_0095302
209 Ga0496126_0000726
210 Ga0501303_001079
211 Ga0501251_001812
212 Ga0501241_000026
213 Ga0501269_000152
214 2511232760
215 2585159534
216 2585163790
217 2585426462
218 2587679038
219 2587749025
220 2587752172
221 2587868245
222 2587942379
223 2588211660
224 2588216686
225 2588220763
226 2588226041
227 2588231157
228 2588447958
229 2590603487
230 2590610622
231 2729202362
232 2738699905
233 2739253654
234 2740060821
235 2753674857
236 2765576105
237 2772605971
238 2775673972
239 2816875783
240 2842087383
241 2871724461
242 2889293397
243 2906002421
244 2919100070
245 2919401422
246 2945928527
247 2946020016
248 2977247340
249 2984574816
250 2984608269
251 2993376367
252 2993483162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

102

173

0.91

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

53

180

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

165

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

81

167

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.9149 2 165
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.8941 2 165
2fiw-assembly1.cif.gz_A crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris 0.8939 2 165
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.8923 2 167
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.891 2 167
ID Description Score Start End Superfamily
3fncA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9004 2 164 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8945 2 165 3.40.630.30
3k9uB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8904 2 162 3.40.630.30
af_Q2G0G4_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8877 2 161 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8839 6 165 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1M5DD22-F1-model_v4 L-amino acid N-acyltransferase YncA 1 2 167 GO:0016747
AF-A0A1M5DD22-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9885 2 167 GO:0016747
AF-A0A2R7N7F4-F1-model_v4 GNAT family N-acetyltransferase 0.9844 1 78 GO:0016740
AF-A0A267T6B9-F1-model_v4 GNAT family N-acetyltransferase 0.9743 2 165 GO:0016747
AF-A0A2C6CSF9-F1-model_v4 GNAT family N-acetyltransferase 0.9697 2 165 GO:0016747

Map