F130403

General Info

Members Datasets Scaffolds Average Seq Length
126 106 253 240

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10079759|Ga0157370_100797594
Length 273
Sequence MGCSGRSGPSFFISRILKNKYISVTIQGKPAYTMKQCRILAGISFLLLVISFAVKAQTADDRFITYTADLKKQHLQLYWKDDQHKPFGSIQRLKSWLEAHKQQLVFAMNGGMYKPDHSPQGLYIENSSTLSPLDTANGNGNFYLQPNGVFYITTDNIPVICKTADFKDNDKVKYATQSGPMLLIEGQLHAAFKEGSANLNIRNGVGILPDGRVVFVMSKQSVNFYDFAGYFKSLGCRNALYLDGFVSRMYVPEKEWRQLDGDFGVMIGVVEER

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
30 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
90 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
91 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
92 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
93 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
94 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
95 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
96 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
97 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
98 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
99 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
100 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
101 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
102 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
103 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
104 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
105 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
106 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.05
Nodule 2.38
Rhizoplane 0.79
Rhizosphere 62.7
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10079759 3300013104 Bacteria 3082
2 SwRhRL2b_contig_3504657 2162886007 Bacteria 830
3 JGI24740J21852_10006620 3300001979 Unclassified 4779
4 JGI25154J39366_1000054 3300002738 Bacteria 117961
5 JGI25157J39369_1001781 3300002741 Bacteria 6986
6 JGI25153J46596_10037072 3300003215 Bacteria 1555
7 rootH1_10020455 3300003316 Bacteria 7263
8 rootH1_10020455 3300003323 Bacteria 13860
9 rootL2_10288895 3300003322 Bacteria 1438
10 rootL2_10337007 3300003322 Bacteria 3378
11 rootH1_10032769 3300003323 Bacteria 17918
12 Ga0055526_1022597 3300003771 Bacteria 2133
13 Ga0065165_1000112 3300005262 Bacteria 135988
14 Ga0065165_1001983 3300005262 Bacteria 19290
15 Ga0065165_1004229 3300005262 Bacteria 9127
16 Ga0065714_10015841 3300005288 Bacteria 2023
17 Ga0065704_10096344 3300005289 Bacteria 2446
18 Ga0065712_10154400 3300005290 Bacteria 1345
19 Ga0070670_100091352 3300005331 Bacteria 2618
20 Ga0070675_100769276 3300005354 Bacteria 879
21 Ga0070678_100099162 3300005456 Bacteria 2254
22 Ga0070678_100359435 3300005456 Bacteria 1254
23 Ga0068867_100103400 3300005459 Bacteria 2179
24 Ga0070672_100187219 3300005543 Bacteria 1727
25 Ga0068855_100014582 3300005563 Bacteria 9466
26 Ga0068857_100384160 3300005577 Bacteria 1304
27 Ga0068856_100000078 3300005614 Bacteria 93041
28 Ga0068856_100037903 3300005614 Bacteria 4731
29 Ga0068852_100059316 3300005616 Bacteria 3318
30 Ga0068859_100481257 3300005617 Bacteria 1337
31 Ga0075366_10048825 3300006195 Unclassified 2510
32 Ga0097621_100028944 3300006237 Bacteria 4372
33 Ga0068871_100277651 3300006358 Unclassified 1465
34 Ga0068871_100408033 3300006358 Bacteria 1211
35 Ga0097620_100481203 3300006931 Bacteria 1337
36 Ga0099824_1005721 3300006942 Bacteria 17401
37 Ga0099826_10004388 3300006948 Bacteria 9878
38 Ga0105244_10000003 3300009036 Bacteria 494610
39 Ga0105240_10345281 3300009093 Bacteria 1690
40 Ga0105240_10496480 3300009093 Bacteria 1358
41 Ga0111539_10133256 3300009094 Bacteria 2909
42 Ga0105241_10009586 3300009174 Bacteria 7118
43 Ga0105237_10206561 3300009545 Bacteria 1964
44 Ga0105237_10731783 3300009545 Unclassified 996
45 Ga0157371_10147429 3300013102 Bacteria 1677
46 Ga0157369_10312709 3300013105 Unclassified 1633
47 Ga0157374_10059412 3300013296 Bacteria 3575
48 Ga0163162_10223294 3300013306 Bacteria 2013
49 Ga0157372_10209647 3300013307 Bacteria 2258
50 Ga0157375_10389025 3300013308 Bacteria 1561
51 Ga0157375_10490738 3300013308 Bacteria 1393
52 Ga0157380_10006633 3300014326 Bacteria 8165
53 Ga0163161_10000177 3300017792 Bacteria 58594
54 Ga0209646_1000009 3300025246 Bacteria 652154
55 Ga0209026_1000133 3300025250 Bacteria 117872
56 Ga0209564_1001758 3300025295 Bacteria 20227
57 Ga0209564_1010164 3300025295 Bacteria 4373
58 Ga0209758_1001132 3300025297 Bacteria 34267
59 Ga0209758_1004484 3300025297 Bacteria 11597
60 Ga0209050_1001312 3300025298 Bacteria 27893
61 Ga0207426_1000203 3300025302 Bacteria 142379
62 Ga0207426_1016274 3300025302 Bacteria 2675
63 Ga0209051_1029809 3300025303 Bacteria 2129
64 Ga0209257_1003436 3300025304 Bacteria 13591
65 Ga0207655_1000010 3300025728 Bacteria 649325
66 Ga0207654_10038038 3300025911 Bacteria 2697
67 Ga0207695_10000139 3300025913 Bacteria 216873
68 Ga0207695_10032001 3300025913 Bacteria 5761
69 Ga0207671_10398447 3300025914 Bacteria 1094
70 Ga0207694_10087625 3300025924 Bacteria 2453
71 Ga0207650_10022916 3300025925 Bacteria 4424
72 Ga0207706_10318747 3300025933 Bacteria 1353
73 Ga0207691_10086394 3300025940 Bacteria 2814
74 Ga0207667_10000037 3300025949 Bacteria 297252
75 Ga0207667_10007060 3300025949 Bacteria 13571
76 Ga0207639_10194406 3300026041 Bacteria 1735
77 Ga0207702_10000765 3300026078 Bacteria 34169
78 Ga0207702_10053410 3300026078 Bacteria 3420
79 Ga0207648_10179145 3300026089 Bacteria 1875
80 Ga0207683_10126748 3300026121 Bacteria 2294
81 Ga0207683_10141547 3300026121 Bacteria 2168
82 Ga0207698_10130013 3300026142 Bacteria 2150
83 Ga0209282_1015972 3300027666 Bacteria 4774
84 Ga0268264_10377650 3300028381 Bacteria 1356
85 Ga0307515_10000001 3300028794 Bacteria 4259510
86 Ga0307515_10001565 3300028794 Bacteria 51101
87 Ga0307508_10001931 3300031616 Bacteria 22740
88 Ga0307414_10423451 3300032004 Bacteria 1161
89 Ga0307411_10000005 3300032005 Bacteria 391311
90 Ga0307507_10000111 3300033179 Bacteria 134722
91 Ga0395900_0014207 3300037418 Bacteria 8129
92 Ga0395905_0007047 3300037471 Bacteria 11236
93 Ga0395901_0031132 3300038443 Bacteria 5501
94 Ga0439447_000239 3300041407 Bacteria 19387
95 Ga0439466_0012528 3300041411 Bacteria 3122
96 Ga0451577_0796840 3300042876 Bacteria 853
97 Ga0466972_0053735 3300044658 Bacteria 1939
98 Ga0453684_0006563 3300044712 Bacteria 22017
99 Ga0495616_0063122 3300046513 Bacteria 1812
100 Ga0495648_0135147 3300046524 Bacteria 1305
101 Ga0495652_0186710 3300046529 Bacteria 1586
102 Ga0495633_0000083 3300046558 Bacteria 125035
103 Ga0495668_0000055 3300046616 Bacteria 199412
104 Ga0495668_0002772 3300046616 Bacteria 13985
105 Ga0495668_0002855 3300046616 Bacteria 13713
106 Ga0495668_0288041 3300046616 Bacteria 900
107 Ga0495625_0028596 3300046660 Bacteria 4179
108 Ga0496115_0013262 3300048918 Bacteria 6229
109 Ga0496126_0003291 3300048929 Bacteria 20585
110 Ga0501266_000025 3300049763 Bacteria 67199
111 nmdc:mga07m45_267010_c1 3300050496 Bacteria 995
112 Ga0500644_0000163 3300053088 Bacteria 42053
113 Ga0500618_014306 3300053125 Unclassified 2029
114 Ga0500642_0120622 3300053130 Bacteria 1226
115 Ga0500559_0031427 3300053136 Bacteria 2278
116 Ga0500590_169978 3300053148 Bacteria 960
117 Ga0500616_0000685 3300053153 Bacteria 39676
118 Ga0500633_0006151 3300053160 Bacteria 2920
119 Ga0500634_0028854 3300053161 Unclassified 3023
120 2644011762 2643221600 Bacteria 5530138
121 2738736207 2738541279 Bacteria 6149495
122 2738768650 2738541285 Bacteria 6150075
123 2739217789 2738543007 Bacteria 6149845
124 2772605211 2772190705 Bacteria 4666226
125 2919510438 2919509842 Bacteria 4104664
126 2965320501 2965320100 Bacteria 3975600
127 8003152562 8003151029 Bacteria 8187759
128 Ga0157370_10079759
129 SwRhRL2b_contig_3504657
130 JGI24740J21852_10006620
131 JGI25154J39366_1000054
132 JGI25157J39369_1001781
133 JGI25153J46596_10037072
134 rootH1_10020455
135 rootL2_10288895
136 rootL2_10337007
137 rootH1_10032769
138 Ga0055526_1022597
139 Ga0065165_1000112
140 Ga0065165_1001983
141 Ga0065165_1004229
142 Ga0065714_10015841
143 Ga0065704_10096344
144 Ga0065712_10154400
145 Ga0070670_100091352
146 Ga0070675_100769276
147 Ga0070678_100099162
148 Ga0070678_100359435
149 Ga0068867_100103400
150 Ga0070672_100187219
151 Ga0068855_100014582
152 Ga0068857_100384160
153 Ga0068856_100000078
154 Ga0068856_100037903
155 Ga0068852_100059316
156 Ga0068859_100481257
157 Ga0075366_10048825
158 Ga0097621_100028944
159 Ga0068871_100277651
160 Ga0068871_100408033
161 Ga0097620_100481203
162 Ga0099824_1005721
163 Ga0099826_10004388
164 Ga0105244_10000003
165 Ga0105240_10345281
166 Ga0105240_10496480
167 Ga0111539_10133256
168 Ga0105241_10009586
169 Ga0105237_10206561
170 Ga0105237_10731783
171 Ga0157371_10147429
172 Ga0157369_10312709
173 Ga0157374_10059412
174 Ga0163162_10223294
175 Ga0157372_10209647
176 Ga0157375_10389025
177 Ga0157375_10490738
178 Ga0157380_10006633
179 Ga0163161_10000177
180 Ga0209646_1000009
181 Ga0209026_1000133
182 Ga0209564_1001758
183 Ga0209564_1010164
184 Ga0209758_1001132
185 Ga0209758_1004484
186 Ga0209050_1001312
187 Ga0207426_1000203
188 Ga0207426_1016274
189 Ga0209051_1029809
190 Ga0209257_1003436
191 Ga0207655_1000010
192 Ga0207654_10038038
193 Ga0207695_10000139
194 Ga0207695_10032001
195 Ga0207671_10398447
196 Ga0207694_10087625
197 Ga0207650_10022916
198 Ga0207706_10318747
199 Ga0207691_10086394
200 Ga0207667_10000037
201 Ga0207667_10007060
202 Ga0207639_10194406
203 Ga0207702_10000765
204 Ga0207702_10053410
205 Ga0207648_10179145
206 Ga0207683_10126748
207 Ga0207683_10141547
208 Ga0207698_10130013
209 Ga0209282_1015972
210 Ga0268264_10377650
211 Ga0307515_10000001
212 Ga0307515_10001565
213 Ga0307508_10001931
214 Ga0307414_10423451
215 Ga0307411_10000005
216 Ga0307507_10000111
217 Ga0395900_0014207
218 Ga0395905_0007047
219 Ga0395901_0031132
220 Ga0439447_000239
221 Ga0439466_0012528
222 Ga0451577_0796840
223 Ga0466972_0053735
224 Ga0453684_0006563
225 Ga0495616_0063122
226 Ga0495648_0135147
227 Ga0495652_0186710
228 Ga0495633_0000083
229 Ga0495668_0000055
230 Ga0495668_0002772
231 Ga0495668_0002855
232 Ga0495668_0288041
233 Ga0495625_0028596
234 Ga0496115_0013262
235 Ga0496126_0003291
236 Ga0501266_000025
237 nmdc:mga07m45_267010_c1
238 Ga0500644_0000163
239 Ga0500618_014306
240 Ga0500642_0120622
241 Ga0500559_0031427
242 Ga0500590_169978
243 Ga0500616_0000685
244 Ga0500633_0006151
245 Ga0500634_0028854
246 2644011762
247 2738736207
248 2738768650
249 2739217789
250 2772605211
251 2919510438
252 2965320501
253 8003152562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09992

NAGPA

Phosphodiester glycosidase

102

267

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ohg-assembly1.cif.gz_A crystal structure of a protein with unknown function from duf2233 family (bacova_00430) from bacteroides ovatus at 1.80 a resolution 0.7225 33 243
6pky-assembly1.cif.gz_A guinea pig n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain auto-inhibited by pro-peptide 0.7158 33 239
6pky-assembly2.cif.gz_C guinea pig n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain auto-inhibited by pro-peptide 0.7137 33 239
6u11-assembly1.cif.gz_A-2 xenopus laevis n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) (c46s c219s c453s c480s c486s) with ctd mostly flexible 0.708 33 242
6pku-assembly2.cif.gz_D guinea pig n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c51s c221s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.6996 33 239
ID Description Score Start End Superfamily
af_P47110_1_93_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7911 117 148 1.20.140.150
1yn5B00 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.6128 115 150 3.10.20.120
af_Q2FWW1_156_258_3.10.20.120 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.6088 115 150 3.10.20.120
af_Q4DYL6_354_420_2.60.60.20 Mainly Beta;Sandwich;Lipoxygenase-1;PLAT/LH2 domain 0.5992 107 135 2.60.60.20
af_Q7KTW9_18_204_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.5775 108 150 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A6M6BC33-F1-model_v4 Phosphodiester glycosidase domain-containing protein 0.9844 29 244
AF-A0A076HVJ9-F1-model_v4 Phosphodiester glycosidase domain-containing protein 0.9824 32 241
AF-A0A2A5EER1-F1-model_v4 Phosphodiester glycosidase domain-containing protein 0.9816 48 241
AF-A0A520J777-F1-model_v4 Phosphodiester glycosidase domain-containing protein 0.9814 26 243
AF-A0A1Q3GWL5-F1-model_v4 Phosphodiester glycosidase domain-containing protein 0.9785 33 242

Map