F135403

General Info

Members Datasets Scaffolds Average Seq Length
127 103 254 279

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_036939|Ga0495627_036939_222_1124
Length 300
Sequence LLFKSNSALAKTYLNQTKKINKMSSIISPSQLKNLPTENLIILDARVGKDIHQTYLNHHIKGARFIDLDKDLAEIGEDAAFGGRHPLPDVEKFAETLSNLGISEDSHIVIYDDKNGANAAARAWWMLKSFGFEKVQVLDGGFQAAEKEGVEFSSSEEIFEKTELIKKDNWLLPTSMLETVENELINNSSTVIDVRDAYRYNGESEPIDLIAGHIPGAINIPFSENLDENGNFLSPEILKEKYSKLLQGKPQNLIIHCGSGVTACHTILALDYAGLEIPNLYVGSWSEWSRREGKEIAKEI

Samples

Sample ID Description Type Environment
1 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
34 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
37 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
38 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
39 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
40 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
41 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
42 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
43 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
44 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
45 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
46 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
47 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
48 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
49 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
50 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
51 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
52 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
53 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
54 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
55 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
56 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
57 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
58 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
59 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
60 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
61 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
62 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
63 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
64 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
65 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
66 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
67 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
68 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
69 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
70 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
71 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
72 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
73 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
74 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
75 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
76 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
77 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
78 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
79 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
80 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
81 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
82 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
83 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
84 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
85 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
86 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
87 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
88 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
89 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
90 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
91 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
92 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
93 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
94 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
95 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
96 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
97 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
98 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
99 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
100 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
101 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
102 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
103 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.08
Metatranscriptomes 0
Isolates 29.92

Biome Distribution

Category Percentage (%)
Aerial Root 1.57
Bulb 0
Endosphere 0.79
Nodule 0.79
Rhizoplane 1.57
Rhizosphere 73.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495627_036939 3300046453 Bacteria 1516
2 JGI24741J21665_1000054 3300001915 Bacteria 28265
3 rootH2_10065994 3300003320 Bacteria 3253
4 rootH1_10058790 3300003323 Bacteria 9765
5 Ga0065714_10002224 3300005288 Bacteria 45363
6 Ga0065704_10073892 3300005289 Bacteria 6697
7 Ga0070683_100000389 3300005329 Bacteria 30361
8 Ga0070682_100000062 3300005337 Bacteria 105099
9 Ga0070660_100017934 3300005339 Bacteria 5165
10 Ga0070668_100021662 3300005347 Bacteria 4856
11 Ga0070668_100123863 3300005347 Bacteria 2069
12 Ga0070684_100001183 3300005535 Bacteria 18755
13 Ga0068863_100126828 3300005841 Bacteria 2435
14 Ga0105244_10000005 3300009036 Bacteria 481412
15 Ga0105250_10004753 3300009092 Bacteria 6195
16 Ga0111539_10008677 3300009094 Bacteria 12901
17 Ga0105243_10000064 3300009148 Bacteria 126487
18 Ga0105243_10034694 3300009148 Bacteria 3908
19 Ga0157373_10000158 3300013100 Bacteria 54838
20 Ga0157371_10000012 3300013102 Bacteria 355318
21 Ga0157371_10333286 3300013102 Bacteria 1103
22 Ga0157370_10017557 3300013104 Bacteria 7219
23 Ga0157370_10056991 3300013104 Bacteria 3717
24 Ga0157370_10095238 3300013104 Bacteria 2793
25 Ga0157370_10258125 3300013104 Bacteria 1611
26 Ga0157370_10620722 3300013104 Bacteria 989
27 Ga0157369_10002543 3300013105 Bacteria 21814
28 Ga0157375_10047940 3300013308 Bacteria 4176
29 Ga0157375_10454307 3300013308 Bacteria 1447
30 Ga0182008_10000005 3300014497 Bacteria 386556
31 Ga0182006_1000001 3300015261 Bacteria 1091090
32 Ga0163161_10005847 3300017792 Bacteria 8526
33 Ga0209675_1000022 3300025291 Bacteria 315280
34 Ga0207655_1000016 3300025728 Bacteria 551476
35 Ga0207657_10054000 3300025919 Bacteria 3477
36 Ga0207709_10000080 3300025935 Bacteria 165667
37 Ga0207709_10212935 3300025935 Bacteria 1388
38 Ga0207661_10000466 3300025944 Bacteria 26139
39 Ga0207668_10004039 3300025972 Bacteria 8627
40 Ga0207668_10042239 3300025972 Bacteria 3087
41 Ga0207641_10200831 3300026088 Bacteria 1838
42 Ga0207641_10329913 3300026088 Bacteria 1449
43 Ga0307515_10219718 3300028794 Bacteria 1721
44 Ga0307413_10000058 3300031824 Bacteria 28566
45 Ga0307412_10000006 3300031911 Bacteria 506878
46 Ga0307412_10000419 3300031911 Bacteria 25928
47 Ga0307416_100000021 3300032002 Bacteria 189730
48 Ga0307414_10000025 3300032004 Bacteria 199049
49 Ga0307414_10079525 3300032004 Bacteria 2394
50 Ga0307414_10127147 3300032004 Bacteria 1971
51 Ga0439465_0000022 3300041413 Bacteria 31864
52 Ga0439445_0000155 3300042004 Bacteria 12086
53 Ga0495627_000012 3300046453 Bacteria 345654
54 Ga0495590_0002815 3300046457 Bacteria 7176
55 Ga0495606_0003893 3300046507 Bacteria 15383
56 Ga0495610_0000005 3300046512 Bacteria 924111
57 Ga0495632_0001915 3300046519 Bacteria 16644
58 Ga0495643_0039489 3300046522 Bacteria 2581
59 Ga0495648_0021092 3300046524 Bacteria 4523
60 Ga0495663_0000018 3300046525 Bacteria 131320
61 Ga0495654_0000003 3300046530 Bacteria 863485
62 Ga0495609_0000003 3300046538 Bacteria 711547
63 Ga0495633_0000001 3300046558 Bacteria 801972
64 Ga0495633_0000536 3300046558 Bacteria 37862
65 Ga0495625_0000148 3300046660 Bacteria 106591
66 Ga0495686_0000224 3300047472 Bacteria 104239
67 Ga0495686_0002285 3300047472 Bacteria 18398
68 Ga0496103_0067990 3300048906 Bacteria 2226
69 Ga0496113_0047739 3300048916 Bacteria 3183
70 Ga0496116_0000051 3300048919 Bacteria 305038
71 Ga0496117_0000007 3300048920 Bacteria 720505
72 Ga0496118_0000140 3300048921 Bacteria 128335
73 Ga0496119_0000028 3300048922 Bacteria 244677
74 Ga0496120_0050476 3300048923 Bacteria 2382
75 Ga0496121_0051496 3300048924 Bacteria 3467
76 Ga0496122_0000181 3300048925 Bacteria 148788
77 Ga0496122_0000237 3300048925 Bacteria 123935
78 Ga0496122_0000422 3300048925 Bacteria 89784
79 Ga0496122_0000656 3300048925 Bacteria 69796
80 Ga0496122_0022558 3300048925 Bacteria 5590
81 Ga0496123_0000837 3300048926 Bacteria 49265
82 Ga0496123_0004919 3300048926 Bacteria 13708
83 Ga0496124_0002500 3300048927 Bacteria 23919
84 Ga0496125_0001246 3300048928 Bacteria 38028
85 Ga0496125_0005595 3300048928 Bacteria 13877
86 Ga0496125_0016636 3300048928 Bacteria 7053
87 Ga0496126_0013847 3300048929 Bacteria 8182
88 Ga0501241_000001 3300049758 Bacteria 233688
89 Ga0501269_000093 3300049766 Bacteria 28080
90 2511233696 2511231000 Bacteria 4488346
91 2585141266 2582581278 Bacteria 5296881
92 2585157103 2582581281 Bacteria 4487904
93 2585161243 2582581282 Bacteria 4495830
94 2585426196 2582581873 Bacteria 3032664
95 2587676879 2585428045 Bacteria 5203023
96 2587746634 2585428060 Bacteria 5304711
97 2587866066 2585428095 Bacteria 3789702
98 2587944485 2585428115 Bacteria 4420269
99 2588211082 2585428182 Bacteria 5007281
100 2588215501 2585428183 Bacteria 5166119
101 2588218912 2585428184 Bacteria 4978681
102 2588224410 2585428185 Bacteria 4969476
103 2588232177 2585428187 Bacteria 4629388
104 2588447163 2588253712 Bacteria 5403181
105 2590602819 2588254255 Bacteria 5014294
106 2590609802 2588254257 Bacteria 5436094
107 2729201181 2728369107 Bacteria 5082720
108 2740060077 2739367874 Bacteria 4872888
109 2753673858 2751185877 Bacteria 4921427
110 2765575272 2765235839 Bacteria 5314748
111 2772603276 2772190705 Bacteria 4666226
112 2775674642 2775506739 Bacteria 3855222
113 2816875124 2816332188 Bacteria 5133218
114 2842084662 2842083920 Bacteria 4857652
115 2871723213 2871720351 Bacteria 4862476
116 2889294194 2889290771 Bacteria 5530962
117 2902051958 2902048731 Bacteria 4976191
118 2905999357 2905999023 Bacteria 4591259
119 2919098258 2919097161 Bacteria 3860339
120 2919401642 2919399522 Bacteria 5164947
121 2945925318 2945924605 Bacteria 4296724
122 2946023705 2946019816 Bacteria 4621265
123 2977244108 2977243572 Bacteria 4374394
124 2984573959 2984572630 Bacteria 4186940
125 2984607406 2984606641 Bacteria 4186971
126 2993375608 2993372514 Bacteria 4214139
127 2993482477 2993480792 Bacteria 4022225
128 Ga0495627_036939
129 JGI24741J21665_1000054
130 rootH2_10065994
131 rootH1_10058790
132 Ga0065714_10002224
133 Ga0065704_10073892
134 Ga0070683_100000389
135 Ga0070682_100000062
136 Ga0070660_100017934
137 Ga0070668_100021662
138 Ga0070668_100123863
139 Ga0070684_100001183
140 Ga0068863_100126828
141 Ga0105244_10000005
142 Ga0105250_10004753
143 Ga0111539_10008677
144 Ga0105243_10000064
145 Ga0105243_10034694
146 Ga0157373_10000158
147 Ga0157371_10000012
148 Ga0157371_10333286
149 Ga0157370_10017557
150 Ga0157370_10056991
151 Ga0157370_10095238
152 Ga0157370_10258125
153 Ga0157370_10620722
154 Ga0157369_10002543
155 Ga0157375_10047940
156 Ga0157375_10454307
157 Ga0182008_10000005
158 Ga0182006_1000001
159 Ga0163161_10005847
160 Ga0209675_1000022
161 Ga0207655_1000016
162 Ga0207657_10054000
163 Ga0207709_10000080
164 Ga0207709_10212935
165 Ga0207661_10000466
166 Ga0207668_10004039
167 Ga0207668_10042239
168 Ga0207641_10200831
169 Ga0207641_10329913
170 Ga0307515_10219718
171 Ga0307413_10000058
172 Ga0307412_10000006
173 Ga0307412_10000419
174 Ga0307416_100000021
175 Ga0307414_10000025
176 Ga0307414_10079525
177 Ga0307414_10127147
178 Ga0439465_0000022
179 Ga0439445_0000155
180 Ga0495627_000012
181 Ga0495590_0002815
182 Ga0495606_0003893
183 Ga0495610_0000005
184 Ga0495632_0001915
185 Ga0495643_0039489
186 Ga0495648_0021092
187 Ga0495663_0000018
188 Ga0495654_0000003
189 Ga0495609_0000003
190 Ga0495633_0000001
191 Ga0495633_0000536
192 Ga0495625_0000148
193 Ga0495686_0000224
194 Ga0495686_0002285
195 Ga0496103_0067990
196 Ga0496113_0047739
197 Ga0496116_0000051
198 Ga0496117_0000007
199 Ga0496118_0000140
200 Ga0496119_0000028
201 Ga0496120_0050476
202 Ga0496121_0051496
203 Ga0496122_0000181
204 Ga0496122_0000237
205 Ga0496122_0000422
206 Ga0496122_0000656
207 Ga0496122_0022558
208 Ga0496123_0000837
209 Ga0496123_0004919
210 Ga0496124_0002500
211 Ga0496125_0001246
212 Ga0496125_0005595
213 Ga0496125_0016636
214 Ga0496126_0013847
215 Ga0501241_000001
216 Ga0501269_000093
217 2511233696
218 2585141266
219 2585157103
220 2585161243
221 2585426196
222 2587676879
223 2587746634
224 2587866066
225 2587944485
226 2588211082
227 2588215501
228 2588218912
229 2588224410
230 2588232177
231 2588447163
232 2590602819
233 2590609802
234 2729201181
235 2740060077
236 2753673858
237 2765575272
238 2772603276
239 2775674642
240 2816875124
241 2842084662
242 2871723213
243 2889294194
244 2902051958
245 2905999357
246 2919098258
247 2919401642
248 2945925318
249 2946023705
250 2977244108
251 2984573959
252 2984607406
253 2993375608
254 2993482477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

28

148

0.83

PF00581

Rhodanese

Rhodanese-like domain

176

291

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1urh-assembly1.cif.gz_A "the ""rhodanese"" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli" 0.8594 1 263
1urh-assembly1.cif.gz_A "the ""rhodanese"" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli" 0.8502 1 263
1h4m-assembly1.cif.gz_X sulfurtransferase from azotobacter vinelandii in complex with phosphate 0.8429 1 266
1urh-assembly2.cif.gz_B "the ""rhodanese"" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli" 0.8424 1 264
3olh-assembly1.cif.gz_A human 3-mercaptopyruvate sulfurtransferase 0.8413 1 271
ID Description Score Start End Superfamily
af_P9WHF5_1_149_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8912 4 143 3.40.250.10
af_Q54E40_34_193_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.854 2 133 3.40.250.10
af_Q4DV84_20_177_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8459 2 148 3.40.250.10
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.845 1 136 3.40.250.10
1h4mX01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8378 1 143 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A4U8WN55-F1-model_v4 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2) 0.9435 1 155 GO:0004792
GO:0016784
AF-A0A4U8WN55-F1-model_v4 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2) 0.9378 1 155 GO:0004792
GO:0016784
AF-A0A2S9ISI3-F1-model_v4 Sulfurtransferase 0.9332 1 175 GO:0004792
AF-A0A1G0RIZ6-F1-model_v4 Sulfurtransferase 0.928 1 268 GO:0004792
AF-A0A1M4YT90-F1-model_v4 Thiosulfate/3-mercaptopyruvate sulfurtransferase 0.9263 1 278 GO:0004792

Map