F138043

General Info

Members Datasets Scaffolds Average Seq Length
128 101 256 459

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10123482|Ga0157372_101234822
Length 518
Sequence MLFNTLSFLLFFPLTTAAYFALPHRRRWAFLLACSTLFYSGWIIVASEKAPWAWLYLLVLAFVILVDYLAGLAIDATQGNLRRLCLVASLLANIGILGVFKYFSFLNLNLHALAEFLHFNFPVRNLGLLLPIGLSFHTFQSMSYTIEVYLGRQRAERHLGIYALYVMFYPQLVAGPIERPQNLLHQLREYHEFDADRIFSGLRLMLWGFFKKVVIADRLAAIVDPIYRDPHAWGGAYLLLATYFFAFQIYCDAIGAARVLGVKLMDNFDRPYAARSIAEFWRRWHISLSTWFRDYLYIPLGGNRVRLPRWCFNIMVVFLISGLWHGASWTFVIWGVLHGFYVIIERAGAHLRQFLLPPSVLRGRHGEAVESKSRRSETPTLTLPRNTGGKNGGRARYTATALKIFITFNLVAVAWVFFRAANLSQAALVLSRIVHGPFLAKPAVALGSLPPFTAADLVLCVLLIVFLEFVQWTIANRKWARAFGLQSTWVRWAAYYALIVTILTIGQLGARSFIYFQF

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
90 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
93 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
94 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
95 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
96 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
97 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
98 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
99 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
100 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
101 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.62
Nodule 0
Rhizoplane 0.78
Rhizosphere 78.12
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10123482 3300013307 Bacteria 2976
2 JGI24739J22299_10009656 3300001989 Bacteria 3591
3 JGI24737J22298_10000153 3300001990 Bacteria 21505
4 JGI24737J22298_10000372 3300001990 Bacteria 15240
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI24735J21928_10000010 3300002067 Bacteria 237152
7 JGI25162J39368_1000627 3300002737 Bacteria 25123
8 JGI25162J39368_1001986 3300002737 Bacteria 9147
9 JGI25164J39214_1001730 3300002772 Bacteria 4388
10 JGI25406J46586_10009916 3300003203 Bacteria 4251
11 JGI25165J46597_1000329 3300003214 Bacteria 56562
12 JGI25165J46597_1002228 3300003214 Bacteria 6775
13 rootH2_10132920 3300003320 Bacteria 5097
14 rootL2_10117239 3300003322 Bacteria 10845
15 rootH1_10004761 3300003323 Bacteria 43462
16 rootH1_10084996 3300003323 Bacteria 8469
17 rootH1_10091813 3300003323 Bacteria 3515
18 Ga0055536_1004846 3300003781 Bacteria 6725
19 Ga0065165_1000130 3300005262 Bacteria 128998
20 Ga0065715_10001814 3300005293 Bacteria 11954
21 Ga0070658_10000301 3300005327 Bacteria 42860
22 Ga0070674_100137495 3300005356 Bacteria 1829
23 Ga0070659_100136698 3300005366 Bacteria 1993
24 Ga0070678_100060162 3300005456 Bacteria 2795
25 Ga0070698_100030724 3300005471 Bacteria 5569
26 Ga0070679_100025491 3300005530 Bacteria 5804
27 Ga0068853_100056412 3300005539 Bacteria 3387
28 Ga0070672_100005200 3300005543 Bacteria 8609
29 Ga0068859_100179521 3300005617 Bacteria 2199
30 Ga0068858_100052881 3300005842 Bacteria 3758
31 Ga0081539_10000082 3300005985 Bacteria 219763
32 Ga0068865_100062511 3300006881 Bacteria 2614
33 Ga0097620_100179521 3300006931 Bacteria 2199
34 Ga0105240_10008182 3300009093 Bacteria 14995
35 Ga0111539_10041710 3300009094 Bacteria 5516
36 Ga0105247_10000565 3300009101 Bacteria 30098
37 Ga0105237_10003241 3300009545 Bacteria 19454
38 Ga0105239_10000298 3300010375 Bacteria 73328
39 Ga0105239_10000860 3300010375 Bacteria 43145
40 Ga0105239_10042173 3300010375 Bacteria 5000
41 Ga0157369_10081460 3300013105 Bacteria 3464
42 Ga0157378_10175859 3300013297 Bacteria 2011
43 Ga0163162_10009941 3300013306 Bacteria 9255
44 Ga0163162_10012814 3300013306 Bacteria 8190
45 Ga0163162_10033817 3300013306 Bacteria 5082
46 Ga0163162_10329836 3300013306 Unclassified 1658
47 Ga0157372_10001199 3300013307 Bacteria 28058
48 Ga0157372_10007694 3300013307 Bacteria 11461
49 Ga0157372_10240474 3300013307 Bacteria 2101
50 Ga0157375_10014981 3300013308 Bacteria 6934
51 Ga0157375_10025919 3300013308 Bacteria 5456
52 Ga0157380_10069321 3300014326 Bacteria 2845
53 Ga0182006_1014773 3300015261 Bacteria 3359
54 Ga0182005_1000085 3300015265 Bacteria 71555
55 Ga0207427_100110 3300025231 Bacteria 113735
56 Ga0207427_100167 3300025231 Bacteria 73496
57 Ga0209437_100034 3300025233 Bacteria 494007
58 Ga0209437_100093 3300025233 Bacteria 239733
59 Ga0209233_1000038 3300025261 Bacteria 548972
60 Ga0209233_1000089 3300025261 Bacteria 316381
61 Ga0209676_1000513 3300025292 Bacteria 60961
62 Ga0207710_10004022 3300025900 Bacteria 6474
63 Ga0207705_10000336 3300025909 Bacteria 42484
64 Ga0207695_10000223 3300025913 Bacteria 151749
65 Ga0207695_10000445 3300025913 Bacteria 90509
66 Ga0207671_10005228 3300025914 Bacteria 12059
67 Ga0207681_10134373 3300025923 Bacteria 1833
68 Ga0207650_10007766 3300025925 Bacteria 7311
69 Ga0207659_10109459 3300025926 Bacteria 2097
70 Ga0207690_10106640 3300025932 Bacteria 2011
71 Ga0207706_10086071 3300025933 Bacteria 2763
72 Ga0207669_10066666 3300025937 Bacteria 2239
73 Ga0207691_10006490 3300025940 Bacteria 11293
74 Ga0207703_10042509 3300026035 Bacteria 3646
75 Ga0207639_10049493 3300026041 Bacteria 3187
76 Ga0207683_10094548 3300026121 Bacteria 2664
77 Ga0207428_10001017 3300027907 Bacteria 31070
78 Ga0265338_10046745 3300028800 Unclassified 3963
79 Ga0265313_10003389 3300031595 Bacteria 12948
80 Ga0316576_10005264 3300031727 Bacteria 7878
81 Ga0307405_10020477 3300031731 Bacteria 3697
82 Ga0307413_10128325 3300031824 Bacteria 1731
83 Ga0307409_100132718 3300031995 Bacteria 2131
84 Ga0307411_10041873 3300032005 Bacteria 2918
85 Ga0395900_0136956 3300037418 Bacteria 2508
86 Ga0395901_0001980 3300038443 Bacteria 21059
87 Ga0451577_0002729 3300042876 Bacteria 20509
88 Ga0453683_0064525 3300044673 Bacteria 2289
89 Ga0453684_0006313 3300044712 Bacteria 22631
90 Ga0453684_0050974 3300044712 Bacteria 5434
91 Ga0451576_0000014 3300045051 Bacteria 593082
92 Ga0495592_0092121 3300046454 Bacteria 2173
93 Ga0495638_0028907 3300046460 Bacteria 3576
94 Ga0495650_0000014 3300046471 Bacteria 581606
95 Ga0495662_0107520 3300046476 Bacteria 1366
96 Ga0495606_0000021 3300046507 Bacteria 271238
97 Ga0495606_0000096 3300046507 Bacteria 151500
98 Ga0495610_0002509 3300046512 Bacteria 15324
99 Ga0495616_0001171 3300046513 Bacteria 18545
100 Ga0495633_0025088 3300046558 Bacteria 2938
101 Ga0495625_0000003 3300046660 Bacteria 686847
102 Ga0495625_0023463 3300046660 Bacteria 4712
103 Ga0495661_0002915 3300046665 Bacteria 12949
104 Ga0495599_0025563 3300046678 Bacteria 3697
105 Ga0495599_0111692 3300046678 Bacteria 1702
106 Ga0495649_0000002 3300046694 Bacteria 1093458
107 Ga0495636_0000120 3300047318 Bacteria 32516
108 Ga0495674_0057331 3300047319 Bacteria 3409
109 Ga0495674_0102020 3300047319 Bacteria 2440
110 Ga0495674_0194018 3300047319 Bacteria 1687
111 Ga0495687_001031 3300047443 Bacteria 27737
112 Ga0495684_0014532 3300047471 Bacteria 6061
113 Ga0495686_0001691 3300047472 Bacteria 22859
114 Ga0501225_0002478 3300049705 Bacteria 5706
115 nmdc:mga0k408_2277_c1 3300050493 Bacteria 10255
116 nmdc:mga08y16_23529_c1 3300050511 Bacteria 6510
117 Ga0500569_000814 3300053109 Bacteria 5503
118 Ga0500658_0005809 3300053134 Bacteria 4597
119 Ga0500577_0015936 3300053142 Bacteria 2359
120 Ga0500616_0003252 3300053153 Bacteria 12578
121 Ga0500616_0034750 3300053153 Bacteria 2744
122 2522551845 2522125168 Bacteria 7376607
123 2599478480 2599185184 Bacteria 6430550
124 2919439680 2919437846 Bacteria 6199444
125 2928080468 2928078545 Bacteria 6534839
126 2928149360 2928147474 Bacteria 6512076
127 2932083194 2932082852 Bacteria 6563563
128 2932086912 2932082852 Bacteria 6563563
129 Ga0157372_10123482
130 JGI24739J22299_10009656
131 JGI24737J22298_10000153
132 JGI24737J22298_10000372
133 JGI24735J21928_10000002
134 JGI24735J21928_10000010
135 JGI25162J39368_1000627
136 JGI25162J39368_1001986
137 JGI25164J39214_1001730
138 JGI25406J46586_10009916
139 JGI25165J46597_1000329
140 JGI25165J46597_1002228
141 rootH2_10132920
142 rootL2_10117239
143 rootH1_10004761
144 rootH1_10084996
145 rootH1_10091813
146 Ga0055536_1004846
147 Ga0065165_1000130
148 Ga0065715_10001814
149 Ga0070658_10000301
150 Ga0070674_100137495
151 Ga0070659_100136698
152 Ga0070678_100060162
153 Ga0070698_100030724
154 Ga0070679_100025491
155 Ga0068853_100056412
156 Ga0070672_100005200
157 Ga0068859_100179521
158 Ga0068858_100052881
159 Ga0081539_10000082
160 Ga0068865_100062511
161 Ga0097620_100179521
162 Ga0105240_10008182
163 Ga0111539_10041710
164 Ga0105247_10000565
165 Ga0105237_10003241
166 Ga0105239_10000298
167 Ga0105239_10000860
168 Ga0105239_10042173
169 Ga0157369_10081460
170 Ga0157378_10175859
171 Ga0163162_10009941
172 Ga0163162_10012814
173 Ga0163162_10033817
174 Ga0163162_10329836
175 Ga0157372_10001199
176 Ga0157372_10007694
177 Ga0157372_10240474
178 Ga0157375_10014981
179 Ga0157375_10025919
180 Ga0157380_10069321
181 Ga0182006_1014773
182 Ga0182005_1000085
183 Ga0207427_100110
184 Ga0207427_100167
185 Ga0209437_100034
186 Ga0209437_100093
187 Ga0209233_1000038
188 Ga0209233_1000089
189 Ga0209676_1000513
190 Ga0207710_10004022
191 Ga0207705_10000336
192 Ga0207695_10000223
193 Ga0207695_10000445
194 Ga0207671_10005228
195 Ga0207681_10134373
196 Ga0207650_10007766
197 Ga0207659_10109459
198 Ga0207690_10106640
199 Ga0207706_10086071
200 Ga0207669_10066666
201 Ga0207691_10006490
202 Ga0207703_10042509
203 Ga0207639_10049493
204 Ga0207683_10094548
205 Ga0207428_10001017
206 Ga0265338_10046745
207 Ga0265313_10003389
208 Ga0316576_10005264
209 Ga0307405_10020477
210 Ga0307413_10128325
211 Ga0307409_100132718
212 Ga0307411_10041873
213 Ga0395900_0136956
214 Ga0395901_0001980
215 Ga0451577_0002729
216 Ga0453683_0064525
217 Ga0453684_0006313
218 Ga0453684_0050974
219 Ga0451576_0000014
220 Ga0495592_0092121
221 Ga0495638_0028907
222 Ga0495650_0000014
223 Ga0495662_0107520
224 Ga0495606_0000021
225 Ga0495606_0000096
226 Ga0495610_0002509
227 Ga0495616_0001171
228 Ga0495633_0025088
229 Ga0495625_0000003
230 Ga0495625_0023463
231 Ga0495661_0002915
232 Ga0495599_0025563
233 Ga0495599_0111692
234 Ga0495649_0000002
235 Ga0495636_0000120
236 Ga0495674_0057331
237 Ga0495674_0102020
238 Ga0495674_0194018
239 Ga0495687_001031
240 Ga0495684_0014532
241 Ga0495686_0001691
242 Ga0501225_0002478
243 nmdc:mga0k408_2277_c1
244 nmdc:mga08y16_23529_c1
245 Ga0500569_000814
246 Ga0500658_0005809
247 Ga0500577_0015936
248 Ga0500616_0003252
249 Ga0500616_0034750
250 2522551845
251 2599478480
252 2919439680
253 2928080468
254 2928149360
255 2932083194
256 2932086912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13813

MBOAT_2

Membrane bound O-acyl transferase family

264

342

0.89

PF03062

MBOAT

MBOAT, membrane-bound O-acyltransferase family

154

359

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6buh-assembly3.cif.gz_F crystal structure of a membrane protein, crystal form ii 0.7659 5 401
6buh-assembly3.cif.gz_F crystal structure of a membrane protein, crystal form ii 0.7351 5 401
7urf-assembly1.cif.gz_A human hhat h379c in complex with shh n-terminal peptide 0.6855 9 431
7q6z-assembly1.cif.gz_A structure of hedgehog acyltransferase (hhat) in complex with megabody 177 bound to imp-1575 0.6675 9 434
7q1u-assembly1.cif.gz_A structure of hedgehog acyltransferase (hhat) in complex with megabody 177 bound to non-hydrolysable palmitoyl-coa (composite map) 0.6576 9 434
ID Description Score Start End Superfamily
af_Q17498_166_435_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5638 121 367 1.20.120.550
af_A0A1D6LT12_239_483_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.55 187 376 1.20.120.550
af_Q960U8_189_547_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5408 44 379 1.20.120.550
af_Q54SV5_129_469_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5351 27 376 1.20.120.550
af_B0UYE4_168_517_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5319 30 397 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A519RUP4-F1-model_v4 MBOAT family protein 0.9882 1 298 GO:0005886
GO:0016746
GO:0042121
AF-A0A849ZGZ7-F1-model_v4 MBOAT family protein 0.9814 1 340 GO:0005886
GO:0016746
GO:0042121
AF-A0A0B0EM78-F1-model_v4 Peptidoglycan O-acetyltransferase (EC 2.3.1.-) 0.9787 1 385 GO:0005886
GO:0016746
GO:0042121
AF-A0A519NUF1-F1-model_v4 deleted 0.9786 33 346
AF-A0A519RUP4-F1-model_v4 MBOAT family protein 0.9785 1 298 GO:0005886
GO:0016746
GO:0042121

Map