F140201

General Info

Members Datasets Scaffolds Average Seq Length
129 83 124 248

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10002436|rootH2_1000243623
Length 271
Sequence MKPAQPENAFFKLEQFGTSSARRKFRVMKDNFSTRADRYAQFRPTYPEALFEHLSQLSPGKEAAWDCGTGNGQVAQRLAAAFQNVQATDISRQQLDNAIVLPNIHYSLQPAERTDFPDHSFDLITVAQAIHWFDFDAFYAEVDRTLKPGGILAVIGYNLPRFNSAVDTVIDGFYRNVIGPFWDKERRYIDENYRTIPFPYADLPSPGFTIDVKWSFDHLIGYIETWSAVKHYQKQKEENPVALVEPGLKAAWGKASRLSGRFPILLRHARV

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
77 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
80 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 0
Rhizosphere 88.37
Stem 0
Stem Tuber 0
Unclassified 10.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10002436 3300003320 Bacteria 28019
2 rootH2_10076560 3300003320 Bacteria 2072
3 rootH2_10290189 3300003320 Bacteria 2776
4 rootH1_10004384 3300003323 Bacteria 9942
5 rootH1_10128633 3300003323 Bacteria 1845
6 rootH1_10136120 3300003323 Bacteria 4489
7 rootH1_10216595 3300003323 Bacteria 1119
8 rootH1_10289556 3300003323 Unclassified 1727
9 Ga0070670_100180544 3300005331 Bacteria 1832
10 Ga0068869_100295701 3300005334 Bacteria 1306
11 Ga0070666_10421487 3300005335 Bacteria 961
12 Ga0070691_10097144 3300005341 Bacteria 1459
13 Ga0070667_100248550 3300005367 Bacteria 1590
14 Ga0070667_100267031 3300005367 Unclassified 1533
15 Ga0070667_100577004 3300005367 Bacteria 1035
16 Ga0068867_100100112 3300005459 Bacteria 2212
17 Ga0068853_100059469 3300005539 Bacteria 3301
18 Ga0068853_100128369 3300005539 Bacteria 2267
19 Ga0070686_100074992 3300005544 Bacteria 2224
20 Ga0070665_100000031 3300005548 Bacteria 333365
21 Ga0068855_100018554 3300005563 Bacteria 8365
22 Ga0068855_100036064 3300005563 Bacteria 5887
23 Ga0068855_100040079 3300005563 Bacteria 5560
24 Ga0068857_100007536 3300005577 Bacteria 9366
25 Ga0068857_100388030 3300005577 Bacteria 1298
26 Ga0068854_100028377 3300005578 Bacteria 3867
27 Ga0068852_100004007 3300005616 Bacteria 10359
28 Ga0068852_100161580 3300005616 Bacteria 2092
29 Ga0068859_100222303 3300005617 Bacteria 1976
30 Ga0068864_100263824 3300005618 Bacteria 1603
31 Ga0068860_100000082 3300005843 Bacteria 169805
32 Ga0068860_100001703 3300005843 Bacteria 23500
33 Ga0068871_100121903 3300006358 Bacteria 2203
34 Ga0097620_100222302 3300006931 Bacteria 1976
35 Ga0105240_10000714 3300009093 Bacteria 60757
36 Ga0105240_10000986 3300009093 Bacteria 50790
37 Ga0105240_10002157 3300009093 Bacteria 32150
38 Ga0105240_10005212 3300009093 Bacteria 19445
39 Ga0105240_10005668 3300009093 Bacteria 18536
40 Ga0105240_10033210 3300009093 Bacteria 6670
41 Ga0105241_10025890 3300009174 Bacteria 4362
42 Ga0105241_10413322 3300009174 Bacteria 1186
43 Ga0105237_10001099 3300009545 Bacteria 36167
44 Ga0105237_10003501 3300009545 Bacteria 18632
45 Ga0105237_10069983 3300009545 Unclassified 3504
46 Ga0105237_10096468 3300009545 Bacteria 2947
47 Ga0105237_10154256 3300009545 Bacteria 2293
48 Ga0105238_10014304 3300009551 Bacteria 8022
49 Ga0105238_10026821 3300009551 Bacteria 5873
50 Ga0105238_10028139 3300009551 Bacteria 5726
51 Ga0105238_10104858 3300009551 Bacteria 2808
52 Ga0105239_10000101 3300010375 Bacteria 119610
53 Ga0105239_10000249 3300010375 Bacteria 80515
54 Ga0105239_10001335 3300010375 Bacteria 33242
55 Ga0105239_10019031 3300010375 Bacteria 7588
56 Ga0157373_10033618 3300013100 Bacteria 3687
57 Ga0157370_10001863 3300013104 Bacteria 26004
58 Ga0157369_10130888 3300013105 Bacteria 2659
59 Ga0157369_10740386 3300013105 Bacteria 1012
60 Ga0157374_10000002 3300013296 Bacteria 1054226
61 Ga0157378_10002898 3300013297 Bacteria 15270
62 Ga0163162_10000473 3300013306 Bacteria 37302
63 Ga0163162_10025471 3300013306 Bacteria 5845
64 Ga0157372_10012232 3300013307 Bacteria 9139
65 Ga0157372_10469785 3300013307 Unclassified 1466
66 Ga0157372_10515464 3300013307 Bacteria 1394
67 Ga0157375_10253045 3300013308 Bacteria 1922
68 Ga0163163_10097134 3300014325 Unclassified 2966
69 Ga0157376_10040194 3300014969 Unclassified 3821
70 Ga0207647_10009362 3300025904 Bacteria 6960
71 Ga0207647_10092632 3300025904 Bacteria 1801
72 Ga0207695_10000447 3300025913 Bacteria 90113
73 Ga0207695_10000981 3300025913 Bacteria 50713
74 Ga0207695_10001270 3300025913 Bacteria 42915
75 Ga0207695_10030363 3300025913 Bacteria 5949
76 Ga0207695_10043091 3300025913 Bacteria 4813
77 Ga0207671_10009836 3300025914 Bacteria 7954
78 Ga0207671_10029044 3300025914 Bacteria 4131
79 Ga0207671_10031478 3300025914 Bacteria 3953
80 Ga0207671_10179575 3300025914 Unclassified 1647
81 Ga0207650_10137774 3300025925 Bacteria 1916
82 Ga0207667_10000598 3300025949 Bacteria 46822
83 Ga0207667_10024100 3300025949 Bacteria 6689
84 Ga0207640_10014324 3300025981 Bacteria 4561
85 Ga0207658_10416674 3300025986 Bacteria 1184
86 Ga0207677_10460418 3300026023 Bacteria 1092
87 Ga0207639_10002258 3300026041 Bacteria 12947
88 Ga0207639_10122337 3300026041 Bacteria 2140
89 Ga0207641_10504212 3300026088 Bacteria 1176
90 Ga0207648_10025914 3300026089 Bacteria 5215
91 Ga0207676_10921496 3300026095 Bacteria 858
92 Ga0207674_10012762 3300026116 Bacteria 9384
93 Ga0207698_10175879 3300026142 Bacteria 1890
94 Ga0207698_10622354 3300026142 Bacteria 1066
95 Ga0209969_1027598 3300027360 Bacteria 861
96 Ga0268266_10000146 3300028379 Bacteria 135225
97 Ga0268265_10151225 3300028380 Unclassified 1958
98 Ga0268264_10000013 3300028381 Bacteria 513859
99 Ga0268264_10009331 3300028381 Bacteria 8123
100 Ga0307517_10158537 3300028786 Bacteria 1527
101 Ga0307515_10000565 3300028794 Bacteria 87276
102 Ga0265327_10005758 3300031251 Bacteria 10205
103 Ga0307514_10016371 3300031649 Bacteria 6109
104 Ga0265314_10111677 3300031711 Bacteria 1736
105 Ga0307412_10087414 3300031911 Bacteria 2172
106 Ga0307411_10025877 3300032005 Bacteria 3523
107 Ga0307415_100021044 3300032126 Bacteria 3999
108 Ga0400487_41006 3300039110 Bacteria 27982
109 Ga0439449_0033855 3300042007 Bacteria 1903
110 Ga0466969_0040511 3300044656 Bacteria 2334
111 Ga0466972_0015987 3300044658 Unclassified 3751
112 Ga0453683_0001174 3300044673 Bacteria 23649
113 Ga0453684_0088135 3300044712 Bacteria 3844
114 Ga0466971_0024994 3300044719 Bacteria 2668
115 Ga0466959_0023996 3300045049 Bacteria 4516
116 Ga0451576_0130082 3300045051 Unclassified 2624
117 Ga0495636_0000047 3300047318 Bacteria 52861
118 Ga0495687_000010 3300047443 Bacteria 413735
119 Ga0496123_0054944 3300048926 Unclassified 2617
120 Ga0501201_006359 3300049651 Unclassified 1119
121 Ga0501217_009111 3300049661 Bacteria 2153
122 Ga0501080_0491955 3300049742 Bacteria 1097
123 Ga0501035_0253191 3300049822 Bacteria 1495
124 Ga0500568_0008891 3300053139 Bacteria 4805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10002898 Ga0157378_100028982 227
2 3300013100 Ga0157373_10033618 Ga0157373_100336184 228
3 3300013296 Ga0157374_10000002 Ga0157374_10000002718 228
4 3300014969 Ga0157376_10040194 Ga0157376_100401942 228
5 3300028786 Ga0307517_10158537 Ga0307517_101585372 228
6 3300005367 Ga0070667_100267031 Ga0070667_1002670312 230
7 3300005548 Ga0070665_100000031 Ga0070665_10000003127 230
8 3300028379 Ga0268266_10000146 Ga0268266_1000014627 230
9 3300013306 Ga0163162_10000473 Ga0163162_1000047328 232
10 3300047443 Ga0495687_000010 Ga0495687_000010_164316_165056 232
11 3300005843 Ga0068860_100000082 Ga0068860_10000008296 236
12 3300009545 Ga0105237_10096468 Ga0105237_100964682 236
13 3300028381 Ga0268264_10000013 Ga0268264_10000013363 236
14 3300031251 Ga0265327_10005758 Ga0265327_100057581 238
15 3300053139 Ga0500568_0008891 Ga0500568_0008891_2137_2919 238
16 iso_pu_bacteria 2965320100 2965322298 239
17 iso_pu_bacteria 2833640130 2833643021 240
18 iso_pu_bacteria 2881955468 2881958008 240
19 iso_pu_bacteria 2883068021 2883068177 240
20 iso_pu_bacteria 2738541278 2738727048 241
21 3300048926 Ga0496123_0054944 Ga0496123_0054944_31_774 243
22 3300003320 rootH2_10076560 rootH2_100765603 244
23 3300003320 rootH2_10290189 rootH2_102901894 244
24 3300003323 rootH1_10128633 rootH1_101286332 244
25 3300003323 rootH1_10289556 rootH1_102895563 244
26 3300005331 Ga0070670_100180544 Ga0070670_1001805442 244
27 3300005334 Ga0068869_100295701 Ga0068869_1002957011 244
28 3300005341 Ga0070691_10097144 Ga0070691_100971441 244
29 3300005367 Ga0070667_100248550 Ga0070667_1002485501 244
30 3300005459 Ga0068867_100100112 Ga0068867_1001001122 244
31 3300005539 Ga0068853_100059469 Ga0068853_1000594693 244
32 3300005539 Ga0068853_100128369 Ga0068853_1001283692 244
33 3300005563 Ga0068855_100018554 Ga0068855_10001855410 244
34 3300005563 Ga0068855_100036064 Ga0068855_1000360643 244
35 3300005577 Ga0068857_100007536 Ga0068857_1000075362 244
36 3300005577 Ga0068857_100388030 Ga0068857_1003880302 244
37 3300005578 Ga0068854_100028377 Ga0068854_1000283772 244
38 3300005616 Ga0068852_100004007 Ga0068852_1000040077 244
39 3300005617 Ga0068859_100222303 Ga0068859_1002223032 244
40 3300005618 Ga0068864_100263824 Ga0068864_1002638242 244
41 3300006358 Ga0068871_100121903 Ga0068871_1001219032 244
42 3300006931 Ga0097620_100222302 Ga0097620_1002223022 244
43 3300009093 Ga0105240_10000714 Ga0105240_1000071441 244
44 3300009093 Ga0105240_10000986 Ga0105240_1000098655 244
45 3300009093 Ga0105240_10033210 Ga0105240_100332103 244
46 3300009174 Ga0105241_10025890 Ga0105241_100258903 244
47 3300009174 Ga0105241_10413322 Ga0105241_104133222 244
48 3300009545 Ga0105237_10001099 Ga0105237_100010993 244
49 3300009545 Ga0105237_10069983 Ga0105237_100699833 244
50 3300009551 Ga0105238_10014304 Ga0105238_100143046 244
51 3300009551 Ga0105238_10026821 Ga0105238_100268212 244
52 3300009551 Ga0105238_10104858 Ga0105238_101048582 244
53 3300010375 Ga0105239_10000101 Ga0105239_1000010168 244
54 3300010375 Ga0105239_10000249 Ga0105239_1000024916 244
55 3300010375 Ga0105239_10001335 Ga0105239_1000133511 244
56 3300010375 Ga0105239_10019031 Ga0105239_100190312 244
57 3300013104 Ga0157370_10001863 Ga0157370_100018636 244
58 3300013105 Ga0157369_10130888 Ga0157369_101308882 244
59 3300013105 Ga0157369_10740386 Ga0157369_107403861 244
60 3300013306 Ga0163162_10025471 Ga0163162_100254712 244
61 3300013307 Ga0157372_10012232 Ga0157372_100122326 244
62 3300013307 Ga0157372_10469785 Ga0157372_104697852 244
63 3300013308 Ga0157375_10253045 Ga0157375_102530451 244
64 3300014325 Ga0163163_10097134 Ga0163163_100971342 244
65 3300025904 Ga0207647_10009362 Ga0207647_100093622 244
66 3300025904 Ga0207647_10092632 Ga0207647_100926323 244
67 3300025913 Ga0207695_10000447 Ga0207695_1000044732 244
68 3300025913 Ga0207695_10000981 Ga0207695_100009812 244
69 3300025913 Ga0207695_10001270 Ga0207695_1000127032 244
70 3300025913 Ga0207695_10043091 Ga0207695_100430912 244
71 3300025914 Ga0207671_10009836 Ga0207671_1000983611 244
72 3300025914 Ga0207671_10179575 Ga0207671_101795752 244
73 3300025925 Ga0207650_10137774 Ga0207650_101377742 244
74 3300025949 Ga0207667_10000598 Ga0207667_1000059830 244
75 3300025981 Ga0207640_10014324 Ga0207640_100143244 244
76 3300025986 Ga0207658_10416674 Ga0207658_104166742 244
77 3300026023 Ga0207677_10460418 Ga0207677_104604182 244
78 3300026041 Ga0207639_10002258 Ga0207639_1000225814 244
79 3300026041 Ga0207639_10122337 Ga0207639_101223372 244
80 3300026088 Ga0207641_10504212 Ga0207641_105042122 244
81 3300026089 Ga0207648_10025914 Ga0207648_100259142 244
82 3300026095 Ga0207676_10921496 Ga0207676_109214961 244
83 3300026116 Ga0207674_10012762 Ga0207674_100127628 244
84 3300026142 Ga0207698_10175879 Ga0207698_101758792 244
85 3300028380 Ga0268265_10151225 Ga0268265_101512252 244
86 3300032005 Ga0307411_10025877 Ga0307411_100258772 244
87 3300044656 Ga0466969_0040511 Ga0466969_0040511_569_1309 244
88 3300044673 Ga0453683_0001174 Ga0453683_0001174_8301_9056 244
89 3300044712 Ga0453684_0088135 Ga0453684_0088135_2435_3178 244
90 3300044719 Ga0466971_0024994 Ga0466971_0024994_1143_1883 244
91 3300045049 Ga0466959_0023996 Ga0466959_0023996_3190_3930 244
92 3300045051 Ga0451576_0130082 Ga0451576_0130082_545_1300 244
93 3300049742 Ga0501080_0491955 Ga0501080_0491955_68_808 244
94 3300049822 Ga0501035_0253191 Ga0501035_0253191_180_917 244
95 3300013307 Ga0157372_10515464 Ga0157372_105154642 245
96 3300027360 Ga0209969_1027598 Ga0209969_10275981 245
97 3300031911 Ga0307412_10087414 Ga0307412_100874141 245
98 3300032126 Ga0307415_100021044 Ga0307415_1000210445 245
99 3300042007 Ga0439449_0033855 Ga0439449_0033855_921_1667 245
100 3300049651 Ga0501201_006359 Ga0501201_006359_80_826 245
101 3300049661 Ga0501217_009111 Ga0501217_009111_948_1694 245
102 3300003323 rootH1_10004384 rootH1_100043848 246
103 3300003323 rootH1_10136120 rootH1_101361203 246
104 3300003323 rootH1_10216595 rootH1_102165952 246
105 3300028794 Ga0307515_10000565 Ga0307515_1000056580 246
106 3300031649 Ga0307514_10016371 Ga0307514_100163714 246
107 3300039110 Ga0400487_41006 Ga0400487_41006_1421_2167 246
108 3300005544 Ga0070686_100074992 Ga0070686_1000749922 247
109 3300031711 Ga0265314_10111677 Ga0265314_101116771 247
110 3300047318 Ga0495636_0000047 Ga0495636_0000047_49652_50395 247
111 3300026142 Ga0207698_10622354 Ga0207698_106223541 248
112 3300009093 Ga0105240_10005668 Ga0105240_1000566814 252
113 3300009545 Ga0105237_10003501 Ga0105237_1000350110 252
114 3300005335 Ga0070666_10421487 Ga0070666_104214871 255
115 3300005367 Ga0070667_100577004 Ga0070667_1005770042 255
116 3300005843 Ga0068860_100001703 Ga0068860_1000017032 255
117 3300025914 Ga0207671_10029044 Ga0207671_100290443 255
118 3300028381 Ga0268264_10009331 Ga0268264_100093318 255
119 3300005563 Ga0068855_100040079 Ga0068855_1000400792 257
120 3300009093 Ga0105240_10005212 Ga0105240_1000521218 257
121 3300025913 Ga0207695_10030363 Ga0207695_100303635 257
122 3300025949 Ga0207667_10024100 Ga0207667_100241005 257
123 3300044658 Ga0466972_0015987 Ga0466972_0015987_1021_1884 257
124 3300009545 Ga0105237_10154256 Ga0105237_101542562 260
125 3300005616 Ga0068852_100161580 Ga0068852_1001615802 262
126 3300009093 Ga0105240_10002157 Ga0105240_1000215725 262
127 3300009551 Ga0105238_10028139 Ga0105238_100281395 262
128 3300025914 Ga0207671_10031478 Ga0207671_100314782 262
129 3300003320 rootH2_10002436 rootH2_1000243623 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

64

150

0.95

PF08241

Methyltransf_11

Methyltransferase domain

65

154

0.93

PF13847

Methyltransf_31

Methyltransferase domain

60

189

0.88

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

52

191

0.8

PF08242

Methyltransf_12

Methyltransferase domain

65

152

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hg2-assembly1.cif.gz_A the structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans. 0.9399 42 270
4hg2-assembly1.cif.gz_A the structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans. 0.9132 42 270
3g5t-assembly1.cif.gz_A crystal structure of trans-aconitate 3-methyltransferase from yeast 0.8532 31 270
3g5l-assembly1.cif.gz_B crystal structure of putative s-adenosylmethionine dependent methyltransferase from listeria monocytogenes 0.8362 51 158
6f5z-assembly1.cif.gz_B complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase 0.8337 36 156
ID Description Score Start End Superfamily
4hg2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9754 159 254 1.10.10.2560
4hg2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9434 42 270 3.40.50.150
af_C0HDZ4_6_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9391 35 270 3.40.50.150
af_Q9LEV6_5_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.933 32 270 3.40.50.150
af_Q54JJ5_11_259_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9294 30 271 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2D9BA78-F1-model_v4 SAM-dependent methyltransferase 0.9838 79 271 GO:0008757
GO:0032259
AF-A0A2W2B6R9-F1-model_v4 SAM-dependent methyltransferase 0.9812 28 271 GO:0008757
GO:0032259
AF-A0A6H9L7V1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9801 29 271 GO:0008757
GO:0032259
AF-U2IZK0-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9786 28 271 GO:0008757
GO:0032259
AF-A0A3D0MJN4-F1-model_v4 deleted 0.9782 36 271

Feature Viewer

pLDDT pTM Quality
85.95 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map