F140280

General Info

Members Datasets Scaffolds Average Seq Length
129 99 252 279

Family's Representative Sequence

Representative Sequence 3300004785|Ga0058858_1246964|Ga0058858_12469641
Length 300
Sequence MRFSKNARRPFGLRAKMIGSAAVVVCLGAMSLASTASAASHSPKGEFAPFAECPLNNLSVTACIYSLSNGGSFTVGTKTVPLKNPVTLQGGAKLNTTTFEQEFVAAENGDTLSKTPQPVPGGLLGITAPNWWPQILRDLFNEVVINGGATGVTATVELAKPASAIKLNLLNLIEAKGTALGLPVKVKLSNAFLGSNCYIGSSSSPLQLNFTTGTNTPITGAVGTLSGNEAGTLITLSGGKLVDNSFSAPGASGCGGILFSWAVDPLVNSILGVPAAAGKNTAILEGKIQSAEAAAVKASE

Samples

Sample ID Description Type Environment
1 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
40 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
68 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
69 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
96 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
97 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
98 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
99 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.6
Metatranscriptomes 12.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 6.98
Rhizosphere 84.5
Stem 0
Stem Tuber 0
Unclassified 23.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058858_1246964 3300004785 Unclassified 1034
2 JGI25404J52841_10005096 3300003659 Bacteria 2703
3 JGI25404J52841_10007343 3300003659 Bacteria 2328
4 Ga0058863_11192725 3300004799 Unclassified 1103
5 Ga0058861_10002303 3300004800 Unclassified 1043
6 Ga0070658_10036546 3300005327 Bacteria 3959
7 Ga0070683_100003234 3300005329 Bacteria 13157
8 Ga0070683_100003613 3300005329 Bacteria 12598
9 Ga0070683_100004049 3300005329 Bacteria 12008
10 Ga0070666_10016079 3300005335 Bacteria 4782
11 Ga0070680_100283285 3300005336 Unclassified 1404
12 Ga0070682_100000011 3300005337 Bacteria 266253
13 Ga0070659_100118948 3300005366 Bacteria 2138
14 Ga0070667_100183356 3300005367 Unclassified 1852
15 Ga0070663_100003524 3300005455 Bacteria 9032
16 Ga0070678_100014618 3300005456 Bacteria 4960
17 Ga0070679_100009869 3300005530 Bacteria 9032
18 Ga0070679_100335829 3300005530 Unclassified 1459
19 Ga0070684_100071783 3300005535 Bacteria 3046
20 Ga0070684_100172023 3300005535 Bacteria 1967
21 Ga0070684_100675346 3300005535 Unclassified 962
22 Ga0068853_100064570 3300005539 Bacteria 3175
23 Ga0068853_100237598 3300005539 Bacteria 1669
24 Ga0068856_100056356 3300005614 Bacteria 3878
25 Ga0068856_100367572 3300005614 Unclassified 1457
26 Ga0068852_100000002 3300005616 Bacteria 268221
27 Ga0068861_100043506 3300005719 Bacteria 3372
28 Ga0068851_10000302 3300005834 Bacteria 22566
29 Ga0068851_10003383 3300005834 Bacteria 7098
30 Ga0068862_100451965 3300005844 Bacteria 1211
31 Ga0081540_1000049 3300005983 Bacteria 127322
32 Ga0081540_1000079 3300005983 Bacteria 103786
33 Ga0081540_1000848 3300005983 Bacteria 27860
34 Ga0070715_10065169 3300006163 Unclassified 1611
35 Ga0075430_100009772 3300006846 Bacteria 8112
36 Ga0105245_10023744 3300009098 Bacteria 5382
37 Ga0105247_10110080 3300009101 Bacteria 1772
38 Ga0105247_10142103 3300009101 Unclassified 1574
39 Ga0105241_10066882 3300009174 Bacteria 2780
40 Ga0105242_10132432 3300009176 Unclassified 2154
41 Ga0105248_10000020 3300009177 Bacteria 284637
42 Ga0105248_10000175 3300009177 Bacteria 74795
43 Ga0105249_10467325 3300009553 Unclassified 1302
44 Ga0105239_10226860 3300010375 Bacteria 2095
45 Ga0157370_10035520 3300013104 Bacteria 4843
46 Ga0157378_10020583 3300013297 Bacteria 5801
47 Ga0163163_10590560 3300014325 Unclassified 1174
48 Ga0157380_10000016 3300014326 Bacteria 126029
49 Ga0157376_10030580 3300014969 Bacteria 4301
50 Ga0197907_10745145 3300020069 Bacteria 8576
51 Ga0197907_11231707 3300020069 Unclassified 1041
52 Ga0206356_10413605 3300020070 Unclassified 967
53 Ga0206356_10689378 3300020070 Bacteria 1743
54 Ga0206355_1549991 3300020076 Unclassified 1039
55 Ga0206355_1573134 3300020076 Unclassified 2583
56 Ga0206351_10245712 3300020077 Bacteria 2339
57 Ga0206350_10320564 3300020080 Bacteria 7959
58 Ga0206350_11349390 3300020080 Unclassified 961
59 Ga0154015_1225237 3300020610 Unclassified 1377
60 Ga0224712_10027870 3300022467 Unclassified 2014
61 Ga0224712_10118259 3300022467 Unclassified 1145
62 Ga0207656_10000183 3300025321 Bacteria 22582
63 Ga0207656_10004242 3300025321 Bacteria 4991
64 Ga0207710_10045800 3300025900 Bacteria 1951
65 Ga0207680_10014659 3300025903 Bacteria 4066
66 Ga0207705_10029939 3300025909 Bacteria 3883
67 Ga0207654_10061516 3300025911 Bacteria 2197
68 Ga0207660_10274695 3300025917 Unclassified 1336
69 Ga0207652_10000480 3300025921 Bacteria 40915
70 Ga0207652_10294708 3300025921 Unclassified 1464
71 Ga0207687_10008450 3300025927 Bacteria 6734
72 Ga0207690_10125024 3300025932 Bacteria 1874
73 Ga0207686_10102833 3300025934 Unclassified 1911
74 Ga0207711_10000006 3300025941 Bacteria 792692
75 Ga0207661_10000458 3300025944 Bacteria 26329
76 Ga0207661_10000921 3300025944 Bacteria 19315
77 Ga0207661_10064696 3300025944 Bacteria 2965
78 Ga0207667_10070116 3300025949 Bacteria 3649
79 Ga0207639_10196208 3300026041 Bacteria 1728
80 Ga0207678_10008562 3300026067 Bacteria 9010
81 Ga0207702_10038294 3300026078 Bacteria 4016
82 Ga0207702_10078591 3300026078 Bacteria 2857
83 Ga0207675_100077517 3300026118 Bacteria 3113
84 Ga0207683_10024637 3300026121 Bacteria 5184
85 Ga0207698_10000004 3300026142 Bacteria 313614
86 Ga0265338_10234991 3300028800 Unclassified 1361
87 Ga0451799_25144 3300041454 Bacteria 951
88 Ga0495582_0000013 3300046473 Bacteria 110372
89 Ga0495630_0000014 3300046517 Bacteria 217229
90 Ga0495652_0000019 3300046529 Bacteria 190248
91 Ga0495667_0000038 3300046559 Bacteria 131349
92 Ga0495646_0189778 3300046680 Bacteria 1124
93 Ga0495658_0000009 3300046683 Bacteria 110421
94 Ga0495658_0000370 3300046683 Bacteria 25240
95 Ga0495613_0000032 3300046689 Bacteria 139806
96 Ga0495624_0000027 3300046690 Bacteria 93611
97 Ga0495600_0003677 3300046809 Bacteria 9062
98 Ga0495604_0010006 3300047317 Bacteria 7507
99 Ga0495680_0003803 3300047322 Bacteria 14653
100 Ga0495602_0000007 3300048088 Bacteria 273212
101 Ga0495602_0015739 3300048088 Bacteria 7621
102 Ga0496103_0144336 3300048906 Unclassified 1523
103 Ga0496104_0183453 3300048907 Bacteria 2003
104 Ga0496108_0035446 3300048911 Bacteria 4148
105 Ga0496109_0000261 3300048912 Bacteria 50812
106 Ga0496110_0000114 3300048913 Bacteria 44437
107 Ga0496111_0000008 3300048914 Bacteria 96148
108 Ga0496113_0000001 3300048916 Bacteria 224977
109 Ga0496113_0000099 3300048916 Bacteria 36270
110 Ga0496116_0000014 3300048919 Bacteria 569049
111 Ga0496117_0131891 3300048920 Unclassified 1513
112 Ga0496118_0166036 3300048921 Viruses 1356
113 Ga0496119_0002414 3300048922 Bacteria 20511
114 Ga0496121_0006671 3300048924 Bacteria 14199
115 Ga0496121_0079736 3300048924 Bacteria 2598
116 Ga0496125_0053741 3300048928 Bacteria 3299
117 Ga0496126_0093120 3300048929 Bacteria 2646
118 Ga0501083_0020644 3300049744 Unclassified 4580
119 nmdc:mga0qj67_7956_c1 3300050509 Bacteria 7834
120 nmdc:mga0rr50_466933_c1 3300050513 Unclassified 1071
121 Ga0495601_0000038 3300053077 Bacteria 81122
122 Ga0495612_0157790 3300053078 Unclassified 989
123 Ga0495595_0004267 3300053084 Bacteria 5748
124 Ga0495619_0000081 3300053085 Bacteria 72034
125 Ga0500641_0001605 3300053096 Bacteria 8050
126 Ga0500568_0076738 3300053139 Bacteria 1272
127 Ga0058858_1246964
128 JGI25404J52841_10005096
129 JGI25404J52841_10007343
130 Ga0058863_11192725
131 Ga0058861_10002303
132 Ga0070658_10036546
133 Ga0070683_100003234
134 Ga0070683_100003613
135 Ga0070683_100004049
136 Ga0070666_10016079
137 Ga0070680_100283285
138 Ga0070682_100000011
139 Ga0070659_100118948
140 Ga0070667_100183356
141 Ga0070663_100003524
142 Ga0070678_100014618
143 Ga0070679_100009869
144 Ga0070679_100335829
145 Ga0070684_100071783
146 Ga0070684_100172023
147 Ga0070684_100675346
148 Ga0068853_100064570
149 Ga0068853_100237598
150 Ga0068856_100056356
151 Ga0068856_100367572
152 Ga0068852_100000002
153 Ga0068861_100043506
154 Ga0068851_10000302
155 Ga0068851_10003383
156 Ga0068862_100451965
157 Ga0081540_1000049
158 Ga0081540_1000079
159 Ga0081540_1000848
160 Ga0070715_10065169
161 Ga0075430_100009772
162 Ga0105245_10023744
163 Ga0105247_10110080
164 Ga0105247_10142103
165 Ga0105241_10066882
166 Ga0105242_10132432
167 Ga0105248_10000020
168 Ga0105248_10000175
169 Ga0105249_10467325
170 Ga0105239_10226860
171 Ga0157370_10035520
172 Ga0157378_10020583
173 Ga0163163_10590560
174 Ga0157380_10000016
175 Ga0157376_10030580
176 Ga0197907_10745145
177 Ga0197907_11231707
178 Ga0206356_10413605
179 Ga0206356_10689378
180 Ga0206355_1549991
181 Ga0206355_1573134
182 Ga0206351_10245712
183 Ga0206350_10320564
184 Ga0206350_11349390
185 Ga0154015_1225237
186 Ga0224712_10027870
187 Ga0224712_10118259
188 Ga0207656_10000183
189 Ga0207656_10004242
190 Ga0207710_10045800
191 Ga0207680_10014659
192 Ga0207705_10029939
193 Ga0207654_10061516
194 Ga0207660_10274695
195 Ga0207652_10000480
196 Ga0207652_10294708
197 Ga0207687_10008450
198 Ga0207690_10125024
199 Ga0207686_10102833
200 Ga0207711_10000006
201 Ga0207661_10000458
202 Ga0207661_10000921
203 Ga0207661_10064696
204 Ga0207667_10070116
205 Ga0207639_10196208
206 Ga0207678_10008562
207 Ga0207702_10038294
208 Ga0207702_10078591
209 Ga0207675_100077517
210 Ga0207683_10024637
211 Ga0207698_10000004
212 Ga0265338_10234991
213 Ga0451799_25144
214 Ga0495582_0000013
215 Ga0495630_0000014
216 Ga0495652_0000019
217 Ga0495667_0000038
218 Ga0495646_0189778
219 Ga0495658_0000009
220 Ga0495658_0000370
221 Ga0495613_0000032
222 Ga0495624_0000027
223 Ga0495600_0003677
224 Ga0495604_0010006
225 Ga0495680_0003803
226 Ga0495602_0000007
227 Ga0495602_0015739
228 Ga0496103_0144336
229 Ga0496104_0183453
230 Ga0496108_0035446
231 Ga0496109_0000261
232 Ga0496110_0000114
233 Ga0496111_0000008
234 Ga0496113_0000001
235 Ga0496113_0000099
236 Ga0496116_0000014
237 Ga0496117_0131891
238 Ga0496118_0166036
239 Ga0496119_0002414
240 Ga0496121_0006671
241 Ga0496121_0079736
242 Ga0496125_0053741
243 Ga0496126_0093120
244 Ga0501083_0020644
245 nmdc:mga0qj67_7956_c1
246 nmdc:mga0rr50_466933_c1
247 Ga0495601_0000038
248 Ga0495612_0157790
249 Ga0495595_0004267
250 Ga0495619_0000081
251 Ga0500641_0001605
252 Ga0500568_0076738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u9e-assembly1.cif.gz_B structure of the regulatory domain of the arac family transcriptional activator rhar 0.4032 51 79
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.3954 195 249
2qq2-assembly2.cif.gz_F crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.3693 166 248
6kad-assembly1.cif.gz_o cryo-em structure of the c2s2m2l2-type psii-lhcii supercomplex from chlamydomonas reihardtii 0.3305 51 248
4o4u-assembly2.cif.gz_B crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant trp-176-ala from haemophilus parasuis hp5 0.3301 40 246
ID Description Score Start End Superfamily
af_Q54ZB6_15_380_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.4123 52 246 2.40.160.10
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.4088 195 249 3.10.420.10
af_Q57803_2_154_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.4044 190 249 3.10.420.10
af_P95257_21_163_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.37 195 248 3.10.420.10
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.3557 52 88 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A1M3BI04-F1-model_v4 Uncharacterized protein 0.8949 78 254
AF-A0A108U965-F1-model_v4 Secreted protein 0.8401 40 257
AF-H0EBW5-F1-model_v4 Putative secreted protein 0.8305 60 257
AF-A0A4V5ZPP4-F1-model_v4 Uncharacterized protein 0.8116 122 254
AF-A0A7W1RAX8-F1-model_v4 CHRD domain-containing protein 0.8038 1 255

Map