F143032

General Info

Members Datasets Scaffolds Average Seq Length
129 108 129 296

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0000212|Ga0495669_0000212_23295_24305
Length 336
Sequence LTVSSRDRAIRKNPWPLIRRLAPALVAFALLVATSGASAAAPSAKETGPPAATVKIRVGHLHGGKGQIYSKVPVTGMLSPFVPGQKVEVSFFLDGKPLLSRKVAVQRGKGGSGSFRASVLLREGGRYAVSAQHEANAVLGGDSTVRKSWTISYPALHQAQCGKVVVGFKKAMRKMGYIANSGRCFGGKTARGVLAYRKVNGLARSYRAGAGLVKSAFLGKGEYHVVHPDAGEHVEAPLSKQVLVFAKGDKPFAVYPISSGKSSTPTVTGHFTFIRQEPGYNSHGMYYSFYFYGGYAVHGYESVPDYPASHGCLRTFIADQPEIYERINFGESIFVF

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
53 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
57 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
64 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
67 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
75 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
106 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
107 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
108 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 13.18
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10000031 3300005333 Bacteria 41799
2 Ga0068868_100005191 3300005338 Bacteria 9144
3 Ga0070691_10000024 3300005341 Bacteria 41375
4 Ga0070661_100000161 3300005344 Bacteria 55183
5 Ga0070674_100000028 3300005356 Bacteria 69584
6 Ga0070673_100002164 3300005364 Bacteria 11898
7 Ga0070688_100000284 3300005365 Bacteria 26015
8 Ga0070659_100185988 3300005366 Bacteria 1706
9 Ga0070662_100000085 3300005457 Bacteria 50770
10 Ga0070685_10000400 3300005466 Bacteria 25975
11 Ga0070685_10061638 3300005466 Bacteria 2197
12 Ga0070693_100003712 3300005547 Bacteria 7142
13 Ga0070665_100001711 3300005548 Bacteria 25181
14 Ga0070704_100282817 3300005549 Bacteria 1375
15 Ga0070664_100013088 3300005564 Bacteria 6752
16 Ga0068866_10002543 3300005718 Bacteria 7514
17 Ga0068851_10001478 3300005834 Bacteria 10313
18 Ga0068863_100000080 3300005841 Bacteria 106670
19 Ga0081539_10000872 3300005985 Bacteria 57857
20 Ga0097621_100076657 3300006237 Bacteria 2774
21 Ga0068871_100081315 3300006358 Bacteria 2684
22 Ga0105247_10071631 3300009101 Bacteria 2168
23 Ga0105243_10127015 3300009148 Unclassified 2159
24 Ga0105241_10198285 3300009174 Unclassified 1675
25 Ga0105238_10000524 3300009551 Bacteria 40236
26 Ga0157374_10002465 3300013296 Bacteria 15626
27 Ga0163162_10193313 3300013306 Bacteria 2163
28 Ga0157375_10007931 3300013308 Bacteria 9296
29 Ga0163163_10056003 3300014325 Bacteria 3897
30 Ga0157380_10000024 3300014326 Bacteria 110947
31 Ga0157380_10000080 3300014326 Bacteria 53731
32 Ga0157376_10055151 3300014969 Bacteria 3316
33 Ga0207682_10000067 3300025893 Bacteria 45608
34 Ga0207642_10000505 3300025899 Bacteria 11957
35 Ga0207710_10051327 3300025900 Bacteria 1852
36 Ga0207680_10013442 3300025903 Bacteria 4205
37 Ga0207680_10041624 3300025903 Bacteria 2682
38 Ga0207649_10000024 3300025920 Bacteria 183104
39 Ga0207681_10053184 3300025923 Unclassified 2749
40 Ga0207694_10000067 3300025924 Bacteria 128108
41 Ga0207644_10317545 3300025931 Bacteria 1259
42 Ga0207690_10172639 3300025932 Bacteria 1621
43 Ga0207706_10000338 3300025933 Bacteria 50849
44 Ga0207709_10080046 3300025935 Unclassified 2103
45 Ga0207669_10000014 3300025937 Bacteria 129145
46 Ga0207691_10000374 3300025940 Bacteria 45009
47 Ga0207661_10058300 3300025944 Bacteria 3107
48 Ga0207651_10371701 3300025960 Unclassified 1209
49 Ga0207677_10002716 3300026023 Bacteria 9328
50 Ga0207641_10000304 3300026088 Bacteria 61194
51 Ga0207676_10000043 3300026095 Bacteria 161948
52 Ga0207683_10002043 3300026121 Bacteria 17862
53 Ga0207698_10018301 3300026142 Bacteria 4771
54 Ga0268266_10000809 3300028379 Bacteria 41366
55 Ga0268266_10024333 3300028379 Bacteria 5152
56 Ga0373933_0120964 3300035724 Unclassified 1640
57 Ga0451839_0390295 3300041496 Bacteria 2281
58 Ga0495629_0000384 3300046459 Bacteria 36987
59 Ga0495629_0010588 3300046459 Bacteria 6708
60 Ga0495629_0363359 3300046459 Bacteria 986
61 Ga0495638_0088689 3300046460 Bacteria 1867
62 Ga0495641_0010691 3300046461 Bacteria 5291
63 Ga0495606_0000082 3300046507 Bacteria 159585
64 Ga0495610_0072679 3300046512 Bacteria 1601
65 Ga0495618_0118665 3300046514 Bacteria 1694
66 Ga0495620_0000119 3300046515 Bacteria 63487
67 Ga0495628_0138270 3300046516 Unclassified 1860
68 Ga0495628_0266246 3300046516 Unclassified 1276
69 Ga0495630_0000037 3300046517 Bacteria 114404
70 Ga0495630_0002802 3300046517 Bacteria 12100
71 Ga0495630_0109331 3300046517 Bacteria 2094
72 Ga0495637_0035164 3300046520 Bacteria 2190
73 Ga0495644_0002839 3300046523 Bacteria 6865
74 Ga0495652_0004243 3300046529 Bacteria 13770
75 Ga0495621_0012625 3300046539 Bacteria 2636
76 Ga0495645_0013456 3300046543 Bacteria 5784
77 Ga0495633_0152113 3300046558 Bacteria 1068
78 Ga0495656_0009561 3300046615 Bacteria 3490
79 Ga0495634_0002989 3300046642 Bacteria 13782
80 Ga0495625_0000020 3300046660 Bacteria 290440
81 Ga0495635_0005816 3300046663 Bacteria 8594
82 Ga0495588_0000240 3300046674 Bacteria 46975
83 Ga0495647_0000003 3300046681 Bacteria 145235
84 Ga0495669_0000212 3300046684 Bacteria 35265
85 Ga0495624_0000135 3300046690 Bacteria 52614
86 Ga0495624_0001826 3300046690 Bacteria 16258
87 Ga0495624_0117560 3300046690 Bacteria 1634
88 Ga0495670_0071147 3300046691 Unclassified 1761
89 Ga0495604_0217813 3300047317 Bacteria 1316
90 Ga0495676_0002505 3300047321 Bacteria 16355
91 Ga0495676_0110083 3300047321 Bacteria 2023
92 Ga0495684_0134515 3300047471 Unclassified 1856
93 Ga0495593_0100232 3300047673 Bacteria 1486
94 Ga0496100_0000008 3300048903 Bacteria 231974
95 Ga0496101_0000016 3300048904 Bacteria 240753
96 Ga0496105_0062987 3300048908 Bacteria 3060
97 Ga0496106_0000086 3300048909 Bacteria 73933
98 Ga0496106_0001663 3300048909 Bacteria 16681
99 Ga0496107_0000009 3300048910 Bacteria 231682
100 Ga0496107_0048052 3300048910 Bacteria 3073
101 Ga0496108_0006097 3300048911 Bacteria 9750
102 Ga0496109_0126641 3300048912 Bacteria 2382
103 Ga0496109_0327790 3300048912 Bacteria 1445
104 Ga0496110_0184531 3300048913 Bacteria 1894
105 Ga0496110_0198492 3300048913 Bacteria 1822
106 Ga0496111_0086221 3300048914 Bacteria 2297
107 Ga0496112_0076729 3300048915 Bacteria 3305
108 Ga0496113_0033746 3300048916 Bacteria 3729
109 Ga0496114_0156427 3300048917 Bacteria 1979
110 Ga0496114_0370415 3300048917 Bacteria 1268
111 Ga0496124_0130544 3300048927 Bacteria 1997
112 Ga0496125_0089358 3300048928 Unclassified 2317
113 Ga0496126_0005610 3300048929 Bacteria 14272
114 Ga0501039_0174223 3300049575 Bacteria 1692
115 Ga0501042_0215365 3300049578 Bacteria 1385
116 Ga0501042_0243301 3300049578 Bacteria 1298
117 Ga0501069_0008490 3300049585 Bacteria 5402
118 Ga0501070_0112522 3300049586 Unclassified 2249
119 Ga0501071_0016204 3300049587 Bacteria 5123
120 Ga0501076_0042595 3300049592 Bacteria 3575
121 Ga0501044_0017217 3300049823 Bacteria 7751
122 Ga0501045_0211739 3300049824 Bacteria 1444
123 Ga0495612_0000432 3300053078 Bacteria 16768
124 Ga0495612_0002402 3300053078 Bacteria 7718
125 Ga0495595_0167907 3300053084 Unclassified 1085
126 Ga0495619_0002664 3300053085 Bacteria 11675
127 Ga0495619_0011864 3300053085 Bacteria 5489
128 Ga0495619_0039327 3300053085 Bacteria 3088
129 Ga0500641_0000786 3300053096 Bacteria 11478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10000872 Ga0081539_1000087233 253
2 3300005841 Ga0068863_100000080 Ga0068863_100000080101 254
3 3300026088 Ga0207641_10000304 Ga0207641_100003045 254
4 3300048912 Ga0496109_0327790 Ga0496109_0327790_47_883 262
5 3300049578 Ga0501042_0243301 Ga0501042_0243301_302_1279 265
6 3300005344 Ga0070661_100000161 Ga0070661_10000016138 266
7 3300005366 Ga0070659_100185988 Ga0070659_1001859881 266
8 3300014326 Ga0157380_10000080 Ga0157380_1000008053 266
9 3300025920 Ga0207649_10000024 Ga0207649_1000002426 266
10 3300028379 Ga0268266_10024333 Ga0268266_100243333 266
11 3300046459 Ga0495629_0363359 Ga0495629_0363359_73_921 266
12 3300046516 Ga0495628_0266246 Ga0495628_0266246_382_1230 266
13 3300046520 Ga0495637_0035164 Ga0495637_0035164_322_1275 266
14 3300047321 Ga0495676_0110083 Ga0495676_0110083_335_1183 266
15 3300049578 Ga0501042_0215365 Ga0501042_0215365_455_1303 266
16 3300053085 Ga0495619_0039327 Ga0495619_0039327_1498_2346 266
17 3300005356 Ga0070674_100000028 Ga0070674_1000000289 267
18 3300025960 Ga0207651_10371701 Ga0207651_103717011 267
19 3300046690 Ga0495624_0000135 Ga0495624_0000135_42619_43584 267
20 3300046691 Ga0495670_0071147 Ga0495670_0071147_49_900 267
21 3300048914 Ga0496111_0086221 Ga0496111_0086221_1156_2007 267
22 3300005834 Ga0068851_10001478 Ga0068851_100014787 268
23 3300009101 Ga0105247_10071631 Ga0105247_100716313 268
24 3300009551 Ga0105238_10000524 Ga0105238_100005245 268
25 3300014326 Ga0157380_10000024 Ga0157380_1000002455 268
26 3300025900 Ga0207710_10051327 Ga0207710_100513271 268
27 3300025924 Ga0207694_10000067 Ga0207694_100000677 268
28 3300048911 Ga0496108_0006097 Ga0496108_0006097_6071_6925 268
29 3300005564 Ga0070664_100013088 Ga0070664_1000130884 269
30 3300048909 Ga0496106_0001663 Ga0496106_0001663_11130_12086 269
31 3300048910 Ga0496107_0048052 Ga0496107_0048052_144_1100 269
32 3300046459 Ga0495629_0000384 Ga0495629_0000384_52_1026 270
33 3300046507 Ga0495606_0000082 Ga0495606_0000082_47366_48334 270
34 3300048913 Ga0496110_0184531 Ga0496110_0184531_643_1602 270
35 3300005548 Ga0070665_100001711 Ga0070665_10000171111 271
36 3300025903 Ga0207680_10013442 Ga0207680_100134424 271
37 3300026142 Ga0207698_10018301 Ga0207698_100183012 271
38 3300028379 Ga0268266_10000809 Ga0268266_1000080924 271
39 3300026121 Ga0207683_10002043 Ga0207683_1000204312 272
40 3300046674 Ga0495588_0000240 Ga0495588_0000240_25875_26840 272
41 3300047317 Ga0495604_0217813 Ga0495604_0217813_94_960 272
42 3300005341 Ga0070691_10000024 Ga0070691_1000002412 273
43 3300053078 Ga0495612_0002402 Ga0495612_0002402_487_1455 273
44 3300005365 Ga0070688_100000284 Ga0070688_10000028421 274
45 3300005466 Ga0070685_10000400 Ga0070685_1000040021 274
46 3300046690 Ga0495624_0117560 Ga0495624_0117560_631_1590 274
47 3300053085 Ga0495619_0011864 Ga0495619_0011864_2374_3333 274
48 3300046512 Ga0495610_0072679 Ga0495610_0072679_29_997 275
49 3300046516 Ga0495628_0138270 Ga0495628_0138270_185_1162 275
50 3300047471 Ga0495684_0134515 Ga0495684_0134515_330_1289 275
51 3300053078 Ga0495612_0000432 Ga0495612_0000432_10791_11768 275
52 3300005466 Ga0070685_10061638 Ga0070685_100616383 276
53 3300046461 Ga0495641_0010691 Ga0495641_0010691_88_1053 276
54 3300046515 Ga0495620_0000119 Ga0495620_0000119_44544_45509 276
55 3300046517 Ga0495630_0002802 Ga0495630_0002802_1227_2189 276
56 3300049592 Ga0501076_0042595 Ga0501076_0042595_583_1569 276
57 3300048913 Ga0496110_0198492 Ga0496110_0198492_827_1804 277
58 3300005338 Ga0068868_100005191 Ga0068868_1000051918 278
59 3300009174 Ga0105241_10198285 Ga0105241_101982851 278
60 3300026023 Ga0207677_10002716 Ga0207677_100027168 278
61 3300048929 Ga0496126_0005610 Ga0496126_0005610_11213_12190 278
62 3300006237 Ga0097621_100076657 Ga0097621_1000766572 279
63 3300013306 Ga0163162_10193313 Ga0163162_101933133 279
64 3300025944 Ga0207661_10058300 Ga0207661_100583002 279
65 3300005364 Ga0070673_100002164 Ga0070673_10000216414 280
66 3300005549 Ga0070704_100282817 Ga0070704_1002828171 281
67 3300046517 Ga0495630_0000037 Ga0495630_0000037_33545_34510 281
68 3300046517 Ga0495630_0109331 Ga0495630_0109331_339_1310 281
69 3300013308 Ga0157375_10007931 Ga0157375_100079316 282
70 3300014969 Ga0157376_10055151 Ga0157376_100551513 282
71 3300025903 Ga0207680_10041624 Ga0207680_100416242 282
72 3300025940 Ga0207691_10000374 Ga0207691_1000037413 282
73 3300035724 Ga0373933_0120964 Ga0373933_0120964_453_1415 282
74 3300046514 Ga0495618_0118665 Ga0495618_0118665_550_1521 282
75 3300048927 Ga0496124_0130544 Ga0496124_0130544_94_1071 282
76 3300046529 Ga0495652_0004243 Ga0495652_0004243_9538_10473 284
77 3300046539 Ga0495621_0012625 Ga0495621_0012625_1079_2038 284
78 3300046543 Ga0495645_0013456 Ga0495645_0013456_2486_3421 284
79 3300046558 Ga0495633_0152113 Ga0495633_0152113_22_945 285
80 3300046642 Ga0495634_0002989 Ga0495634_0002989_2629_3588 285
81 3300047673 Ga0495593_0100232 Ga0495593_0100232_23_982 285
82 3300025931 Ga0207644_10317545 Ga0207644_103175452 286
83 3300048903 Ga0496100_0000008 Ga0496100_0000008_11916_12878 286
84 3300048904 Ga0496101_0000016 Ga0496101_0000016_20698_21660 286
85 3300048909 Ga0496106_0000086 Ga0496106_0000086_61284_62246 286
86 3300048910 Ga0496107_0000009 Ga0496107_0000009_11630_12592 286
87 3300049575 Ga0501039_0174223 Ga0501039_0174223_225_1181 286
88 3300049824 Ga0501045_0211739 Ga0501045_0211739_18_974 286
89 3300053084 Ga0495595_0167907 Ga0495595_0167907_79_1041 286
90 3300041496 Ga0451839_0390295 Ga0451839_0390295_279_1247 287
91 3300048915 Ga0496112_0076729 Ga0496112_0076729_1554_2513 287
92 3300048916 Ga0496113_0033746 Ga0496113_0033746_1427_2386 287
93 3300046660 Ga0495625_0000020 Ga0495625_0000020_287389_288354 288
94 3300005547 Ga0070693_100003712 Ga0070693_1000037125 290
95 3300005457 Ga0070662_100000085 Ga0070662_10000008540 291
96 3300025933 Ga0207706_10000338 Ga0207706_1000033838 291
97 3300046663 Ga0495635_0005816 Ga0495635_0005816_5953_6891 291
98 3300048908 Ga0496105_0062987 Ga0496105_0062987_1274_2287 291
99 3300053085 Ga0495619_0002664 Ga0495619_0002664_7560_8498 291
100 3300005718 Ga0068866_10002543 Ga0068866_100025432 292
101 3300009148 Ga0105243_10127015 Ga0105243_101270152 292
102 3300014325 Ga0163163_10056003 Ga0163163_100560031 292
103 3300025899 Ga0207642_10000505 Ga0207642_100005057 292
104 3300025935 Ga0207709_10080046 Ga0207709_100800462 292
105 3300025937 Ga0207669_10000014 Ga0207669_100000149 292
106 3300006358 Ga0068871_100081315 Ga0068871_1000813152 294
107 3300025923 Ga0207681_10053184 Ga0207681_100531842 295
108 3300025932 Ga0207690_10172639 Ga0207690_101726392 295
109 3300046615 Ga0495656_0009561 Ga0495656_0009561_1447_2388 295
110 3300046460 Ga0495638_0088689 Ga0495638_0088689_62_1018 297
111 3300046523 Ga0495644_0002839 Ga0495644_0002839_106_1068 298
112 3300046681 Ga0495647_0000003 Ga0495647_0000003_138121_139080 298
113 3300048917 Ga0496114_0156427 Ga0496114_0156427_843_1802 298
114 3300053096 Ga0500641_0000786 Ga0500641_0000786_3784_4743 298
115 3300013296 Ga0157374_10002465 Ga0157374_100024656 299
116 3300047321 Ga0495676_0002505 Ga0495676_0002505_8834_9796 299
117 3300048912 Ga0496109_0126641 Ga0496109_0126641_583_1551 299
118 3300026095 Ga0207676_10000043 Ga0207676_100000439 300
119 3300046459 Ga0495629_0010588 Ga0495629_0010588_2424_3395 300
120 3300046690 Ga0495624_0001826 Ga0495624_0001826_11035_12000 300
121 3300048917 Ga0496114_0370415 Ga0496114_0370415_46_1029 300
122 3300048928 Ga0496125_0089358 Ga0496125_0089358_637_1635 300
123 3300049585 Ga0501069_0008490 Ga0501069_0008490_2869_3834 300
124 3300049586 Ga0501070_0112522 Ga0501070_0112522_1012_1977 300
125 3300049587 Ga0501071_0016204 Ga0501071_0016204_3405_4370 300
126 3300049823 Ga0501044_0017217 Ga0501044_0017217_3573_4538 300
127 3300046684 Ga0495669_0000212 Ga0495669_0000212_23295_24305 314
128 3300005333 Ga0070677_10000031 Ga0070677_1000003132 315
129 3300025893 Ga0207682_10000067 Ga0207682_1000006710 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

231

335

0.8

Feature Viewer

pLDDT pTM Quality
57.6 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map