F146014

General Info

Members Datasets Scaffolds Average Seq Length
130 106 260 132

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10001140|Ga0265327_1000114021
Length 137
Sequence MKDLSIRLENRPGSLATLGETLGRAGVSIEGGGAWVVGATGQAHFLVADGEADRARAALADAGLAVSAVRDVVVQKLRQGEPGQLGKLTRRMADAGVNIEVLYSDHANQLVLVVDDPARGRAVADAWMRERAGKAVS

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
64 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
65 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
66 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
67 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
104 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
105 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
106 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.08
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 30.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10001140 3300031251 Bacteria 36351
2 MBSR1b_contig_1253721 2162886012 Bacteria 1224
3 rootH1_10168062 3300003316 Bacteria 2551
4 rootL2_10225994 3300003322 Bacteria 6187
5 Ga0070676_10237259 3300005328 Bacteria 1211
6 Ga0068869_101366368 3300005334 Unclassified 626
7 Ga0070689_100303389 3300005340 Bacteria 1330
8 Ga0070687_100014614 3300005343 Bacteria 3530
9 Ga0070687_100359312 3300005343 Unclassified 942
10 Ga0070674_100945019 3300005356 Unclassified 753
11 Ga0070708_100049192 3300005445 Bacteria 3729
12 Ga0070708_101905542 3300005445 Unclassified 551
13 Ga0070685_10041625 3300005466 Bacteria 2619
14 Ga0070706_100170883 3300005467 Bacteria 2030
15 Ga0070707_100004939 3300005468 Bacteria 12494
16 Ga0070707_100080701 3300005468 Unclassified 3140
17 Ga0070699_100110444 3300005518 Bacteria 2414
18 Ga0070684_100116881 3300005535 Unclassified 2396
19 Ga0070697_100183972 3300005536 Bacteria 1772
20 Ga0070697_101136337 3300005536 Unclassified 695
21 Ga0070686_100241036 3300005544 Bacteria 1317
22 Ga0070695_101140154 3300005545 Bacteria 639
23 Ga0070696_100648020 3300005546 Unclassified 856
24 Ga0070704_100350726 3300005549 Bacteria 1246
25 Ga0070702_100454589 3300005615 Bacteria 930
26 Ga0068859_100124577 3300005617 Bacteria 2645
27 Ga0068859_101796720 3300005617 Bacteria 677
28 Ga0068858_101128090 3300005842 Bacteria 770
29 Ga0068862_100447352 3300005844 Bacteria 1217
30 Ga0081455_10459538 3300005937 Unclassified 867
31 Ga0070717_10000021 3300006028 Bacteria 162915
32 Ga0075428_100355419 3300006844 Bacteria 1572
33 Ga0075431_100042772 3300006847 Bacteria 4674
34 Ga0075433_10223844 3300006852 Bacteria 1671
35 Ga0075433_10237854 3300006852 Unclassified 1617
36 Ga0075434_100087993 3300006871 Bacteria 3107
37 Ga0075434_100197407 3300006871 Bacteria 2032
38 Ga0097620_100124575 3300006931 Bacteria 2645
39 Ga0097620_101795873 3300006931 Bacteria 677
40 Ga0075435_101686979 3300007076 Unclassified 556
41 Ga0111539_10561539 3300009094 Bacteria 1329
42 Ga0114129_10123519 3300009147 Bacteria 3560
43 Ga0157378_11129607 3300013297 Bacteria 821
44 Ga0157377_10216395 3300014745 Bacteria 1224
45 Ga0157376_10142734 3300014969 Unclassified 2150
46 Ga0157376_12630263 3300014969 Bacteria 543
47 Ga0163161_12006800 3300017792 Unclassified 515
48 Ga0207684_10169384 3300025910 Bacteria 1883
49 Ga0207707_10155304 3300025912 Bacteria 2001
50 Ga0207693_10376334 3300025915 Unclassified 1111
51 Ga0207660_10199029 3300025917 Bacteria 1564
52 Ga0207662_10307227 3300025918 Unclassified 1056
53 Ga0207652_10161846 3300025921 Bacteria 2006
54 Ga0207646_10002998 3300025922 Bacteria 19494
55 Ga0207686_10055058 3300025934 Bacteria 2494
56 Ga0207661_10832287 3300025944 Unclassified 850
57 Ga0207658_10633421 3300025986 Bacteria 963
58 Ga0207703_10085287 3300026035 Unclassified 2643
59 Ga0207674_11253843 3300026116 Unclassified 711
60 Ga0207674_11811691 3300026116 Unclassified 577
61 Ga0207675_100784587 3300026118 Unclassified 965
62 Ga0265323_10083350 3300028653 Bacteria 1078
63 Ga0307413_10077548 3300031824 Bacteria 2116
64 Ga0307410_10022268 3300031852 Bacteria 3913
65 Ga0307410_10584792 3300031852 Unclassified 929
66 Ga0307406_10387014 3300031901 Unclassified 1104
67 Ga0307407_10023763 3300031903 Bacteria 3203
68 Ga0307407_10256260 3300031903 Unclassified 1201
69 Ga0307409_100039142 3300031995 Bacteria 3515
70 Ga0307409_100101224 3300031995 Bacteria 2390
71 Ga0307416_100246898 3300032002 Bacteria 1734
72 Ga0307414_10091485 3300032004 Bacteria 2261
73 Ga0307414_11356240 3300032004 Bacteria 660
74 Ga0307411_10020218 3300032005 Bacteria 3867
75 Ga0307411_10110964 3300032005 Bacteria 1962
76 Ga0307415_100369902 3300032126 Unclassified 1213
77 Ga0307415_100633929 3300032126 Bacteria 956
78 Ga0373928_0193765 3300035084 Bacteria 583
79 Ga0373929_0086170 3300035085 Bacteria 773
80 Ga0373940_0124333 3300035088 Bacteria 803
81 Ga0373940_0195330 3300035088 Bacteria 663
82 Ga0373932_0001134 3300035112 Bacteria 7673
83 Ga0373941_0147544 3300035115 Bacteria 860
84 Ga0373960_0065452 3300035121 Bacteria 1112
85 Ga0373931_0224773 3300035691 Bacteria 1132
86 Ga0373937_1171881 3300036401 Bacteria 717
87 Ga0373925_0180018 3300037068 Bacteria 1673
88 Ga0395905_0054172 3300037471 Bacteria 3754
89 Ga0451804_1160486 3300041463 Unclassified 684
90 Ga0451577_0835610 3300042876 Unclassified 831
91 Ga0466966_0116471 3300044684 Bacteria 1645
92 Ga0451576_2489798 3300045051 Unclassified 529
93 Ga0495580_0213157 3300046472 Bacteria 1328
94 Ga0495580_0670756 3300046472 Unclassified 680
95 Ga0495580_0807264 3300046472 Unclassified 608
96 Ga0495643_0000003 3300046522 Bacteria 571962
97 Ga0495587_0636635 3300046536 Unclassified 586
98 Ga0495635_0166255 3300046663 Unclassified 1501
99 Ga0495647_0030525 3300046681 Bacteria 2000
100 Ga0495660_0311275 3300046810 Bacteria 710
101 Ga0495674_0221902 3300047319 Unclassified 1562
102 Ga0495674_1425384 3300047319 Bacteria 515
103 Ga0496104_0663824 3300048907 Unclassified 951
104 Ga0496112_0297232 3300048915 Unclassified 1560
105 Ga0496113_0246647 3300048916 Bacteria 1425
106 Ga0496124_0280176 3300048927 Bacteria 1216
107 Ga0501033_0272053 3300049570 Bacteria 1197
108 Ga0501038_0275462 3300049574 Bacteria 1326
109 Ga0501040_0902980 3300049576 Bacteria 640
110 Ga0501043_0312642 3300049579 Bacteria 1199
111 Ga0501072_0427810 3300049588 Bacteria 1049
112 Ga0501074_1294474 3300049590 Bacteria 511
113 Ga0501080_1124002 3300049742 Unclassified 678
114 Ga0501044_0579746 3300049823 Bacteria 1016
115 nmdc:mga05p37_321327_c1 3300050507 Bacteria 1832
116 nmdc:mga09592_526129_c1 3300050508 Bacteria 1017
117 nmdc:mga0qj67_815750_c1 3300050509 Unclassified 738
118 nmdc:mga06r32_1306977_c1 3300050510 Unclassified 669
119 nmdc:mga0n895_167478_c1 3300050512 Bacteria 2229
120 nmdc:mga0n895_199225_c1 3300050512 Unclassified 2034
121 nmdc:mga0rr50_38690_c1 3300050513 Bacteria 3454
122 nmdc:mga0rr50_511103_c1 3300050513 Bacteria 1022
123 nmdc:mga08x19_345479_c1 3300050514 Bacteria 1038
124 nmdc:mga0a205_1123926_c1 3300050515 Bacteria 633
125 nmdc:mga0a205_283224_c1 3300050515 Bacteria 1533
126 nmdc:mga0a205_298782_c1 3300050515 Unclassified 1483
127 Ga0495619_0421886 3300053085 Unclassified 920
128 8021624305 8021622325 Bacteria 4844743
129 8021628210 8021626552 Bacteria 4665214
130 8021651467 8021648035 Bacteria 4772378
131 Ga0265327_10001140
132 MBSR1b_contig_1253721
133 rootH1_10168062
134 rootL2_10225994
135 Ga0070676_10237259
136 Ga0068869_101366368
137 Ga0070689_100303389
138 Ga0070687_100014614
139 Ga0070687_100359312
140 Ga0070674_100945019
141 Ga0070708_100049192
142 Ga0070708_101905542
143 Ga0070685_10041625
144 Ga0070706_100170883
145 Ga0070707_100004939
146 Ga0070707_100080701
147 Ga0070699_100110444
148 Ga0070684_100116881
149 Ga0070697_100183972
150 Ga0070697_101136337
151 Ga0070686_100241036
152 Ga0070695_101140154
153 Ga0070696_100648020
154 Ga0070704_100350726
155 Ga0070702_100454589
156 Ga0068859_100124577
157 Ga0068859_101796720
158 Ga0068858_101128090
159 Ga0068862_100447352
160 Ga0081455_10459538
161 Ga0070717_10000021
162 Ga0075428_100355419
163 Ga0075431_100042772
164 Ga0075433_10223844
165 Ga0075433_10237854
166 Ga0075434_100087993
167 Ga0075434_100197407
168 Ga0097620_100124575
169 Ga0097620_101795873
170 Ga0075435_101686979
171 Ga0111539_10561539
172 Ga0114129_10123519
173 Ga0157378_11129607
174 Ga0157377_10216395
175 Ga0157376_10142734
176 Ga0157376_12630263
177 Ga0163161_12006800
178 Ga0207684_10169384
179 Ga0207707_10155304
180 Ga0207693_10376334
181 Ga0207660_10199029
182 Ga0207662_10307227
183 Ga0207652_10161846
184 Ga0207646_10002998
185 Ga0207686_10055058
186 Ga0207661_10832287
187 Ga0207658_10633421
188 Ga0207703_10085287
189 Ga0207674_11253843
190 Ga0207674_11811691
191 Ga0207675_100784587
192 Ga0265323_10083350
193 Ga0307413_10077548
194 Ga0307410_10022268
195 Ga0307410_10584792
196 Ga0307406_10387014
197 Ga0307407_10023763
198 Ga0307407_10256260
199 Ga0307409_100039142
200 Ga0307409_100101224
201 Ga0307416_100246898
202 Ga0307414_10091485
203 Ga0307414_11356240
204 Ga0307411_10020218
205 Ga0307411_10110964
206 Ga0307415_100369902
207 Ga0307415_100633929
208 Ga0373928_0193765
209 Ga0373929_0086170
210 Ga0373940_0124333
211 Ga0373940_0195330
212 Ga0373932_0001134
213 Ga0373941_0147544
214 Ga0373960_0065452
215 Ga0373931_0224773
216 Ga0373937_1171881
217 Ga0373925_0180018
218 Ga0395905_0054172
219 Ga0451804_1160486
220 Ga0451577_0835610
221 Ga0466966_0116471
222 Ga0451576_2489798
223 Ga0495580_0213157
224 Ga0495580_0670756
225 Ga0495580_0807264
226 Ga0495643_0000003
227 Ga0495587_0636635
228 Ga0495635_0166255
229 Ga0495647_0030525
230 Ga0495660_0311275
231 Ga0495674_0221902
232 Ga0495674_1425384
233 Ga0496104_0663824
234 Ga0496112_0297232
235 Ga0496113_0246647
236 Ga0496124_0280176
237 Ga0501033_0272053
238 Ga0501038_0275462
239 Ga0501040_0902980
240 Ga0501043_0312642
241 Ga0501072_0427810
242 Ga0501074_1294474
243 Ga0501080_1124002
244 Ga0501044_0579746
245 nmdc:mga05p37_321327_c1
246 nmdc:mga09592_526129_c1
247 nmdc:mga0qj67_815750_c1
248 nmdc:mga06r32_1306977_c1
249 nmdc:mga0n895_167478_c1
250 nmdc:mga0n895_199225_c1
251 nmdc:mga0rr50_38690_c1
252 nmdc:mga0rr50_511103_c1
253 nmdc:mga08x19_345479_c1
254 nmdc:mga0a205_1123926_c1
255 nmdc:mga0a205_283224_c1
256 nmdc:mga0a205_298782_c1
257 Ga0495619_0421886
258 8021624305
259 8021628210
260 8021651467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19571

ACT_8

ACT domain pair

1

129

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v0s-assembly1.cif.gz_B crystal structure of the act domain of prephenate dehydrogenase tyra from bacillus anthracis 0.8771 3 67
5v0s-assembly1.cif.gz_B crystal structure of the act domain of prephenate dehydrogenase tyra from bacillus anthracis 0.8206 3 67
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.816 2 133
5fii-assembly2.cif.gz_D structure of a human aspartate kinase, chorismate mutase and tyra domain. 0.8033 1 71
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.7777 2 133
ID Description Score Start End Superfamily
af_K7KPI3_232_352_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8826 3 50 3.30.70.260
af_I1M2G3_44_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8798 2 47 3.40.50.2000
af_P27249_815_877_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8744 3 53 3.30.70.260
af_I1MCA5_224_286_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8731 4 50 3.30.460.10
af_O81900_105_207_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8704 2 49 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A0A8DTV5-F1-model_v4 deleted 0.9908 1 132
AF-A0A7W0LZT9-F1-model_v4 Amino acid-binding ACT domain-containing protein 0.9868 1 131
AF-D0RK84-F1-model_v4 deleted 0.9847 2 126
AF-A0A7K1Y816-F1-model_v4 Amino acid-binding ACT domain-containing protein 0.9835 1 130
AF-A0A7C3FYQ9-F1-model_v4 Amino acid-binding ACT domain-containing protein 0.9806 1 127

Map